Tuesday, 23 Sep 2025
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Subscribe
Life Care News
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
    NewsShow More
    CGTN AMERICA & CCTV UN: “Beauty in Harmony, Destiny in Unity” Visual Works Exhibition
    CGTN AMERICA & CCTV UN: “Beauty in Harmony, Destiny in Unity” Visual Works Exhibition
    23/09/2025
    AV-Comparatives Publishes 2025 Endpoint Prevention & Response (EPR) Test – The Most Comprehensive Enterprise Cybersecurity Evaluation to Date
    AV-Comparatives Publishes 2025 Endpoint Prevention & Response (EPR) Test – The Most Comprehensive Enterprise Cybersecurity Evaluation to Date
    23/09/2025
    Birla Carbon Releases 2025 Sustainability Report ‘Connected to a Greener Future’
    Birla Carbon Releases 2025 Sustainability Report ‘Connected to a Greener Future’
    22/09/2025
    All-Scenario Grid Forming Technology, Accelerating Wind and Solar as Main Power
    All-Scenario Grid Forming Technology, Accelerating Wind and Solar as Main Power
    22/09/2025
    Huawei and Industry Pioneers Unveil Over 30 Global Benchmark Showcases for Digital and Intelligent Transformation in the Data Communication Domain
    Huawei and Industry Pioneers Unveil Over 30 Global Benchmark Showcases for Digital and Intelligent Transformation in the Data Communication Domain
    21/09/2025
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
  • 🔥
  • news
  • global
  • Business
  • june
  • july
  • announced
  • today
  •  and
  •  the
  • Tech
Font ResizerAa
Life Care NewsLife Care News
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Search
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Follow US
© 2022 Foxiz News Network. Ruby Design Company. All Rights Reserved.
Business

AM Best Assigns Credit Ratings to DavidShield Insurance Company

Business Wire
Last updated: 22/07/2025 12:20 AM
Business Wire
Share
5 Min Read
AM Best Assigns Credit Ratings to DavidShield Insurance Company
SHARE
AM Best Assigns Credit Ratings to DavidShield Insurance Company

LONDON–(BUSINESS WIRE)–AM Best has assigned a Financial Strength Rating of B++ (Good) and a Long-Term Issuer Credit Rating of “bbb+” (Good) to DavidShield Insurance Company (DSIC) (Israel). DSIC is a wholly owned subsidiary of DavidShield PassportCard Ltd (PassportCard Group), which is ultimately majority-owned by its parent company, White Mountains Insurance Group, Ltd. (WTM) [NYSE: WTM]. The outlook assigned to these Credit Ratings (ratings) is stable.

- Advertisement -


- Advertisement -

The ratings reflect DSIC’s balance sheet strength, which AM Best assesses as strong, as well as its adequate operating performance, limited business profile and appropriate enterprise risk management. The ratings also consider the explicit support received from WTM.

DSIC’s balance sheet strength is underpinned by its risk-adjusted capitalisation at the strongest level, as measured by Best’s Capital Adequacy Ratio (BCAR). The company benefits from a conservative investment portfolio, as well as good financial flexibility from WTM and a strong liquidity profile. As per its business model as a fronting company, DSIC is highly dependent on reinsurance; however, this is mitigated partially by the use of highly rated reinsurance partners, with the lead reinsurer having a long-standing, strategic relationship with the company. The balance sheet assessment additionally considers the moderate debt leverage within the wider PassportCard Group.

- Advertisement -

DSIC’s profitability is driven by robust reinsurance commissions and fee income, as evidenced by a five-year (2020-2024) weighted average return on capital and surplus of 23.7%. The company does not retain any underwriting risk. Its earnings have been growing steadily, albeit from a small base, with a compound annual growth rate in before-tax profits of 14.2% in the four years to 2024. DSIC’s book of business has a long history of excellent gross underwriting performance (gross of reinsurance), which ultimately benefits DSIC through reinsurance commissions. The company’s stable investment income further supports its overall operating performance. AM Best’s performance analysis includes consideration of the wider PassportCard Group, which has been constrained as it invests in geographic diversification. AM Best expects the PassportCard Group to become sustainably profitable over the short-to-medium term as its foreign business gains scale.

- Advertisement -

DSIC is a fronting insurer for the PassportCard Group, specialising in travel and international private medical insurance. The company is the market leader for these lines in Israel, with its success driven by its innovative technological customer solutions, primarily the PassportCard product. Whilst it is concentrated in two lines of business, the company benefits from diversification through the geographical spread of its policyholders. It also has a growing insurance administration services business with large international companies that are looking to leverage their unique technology.

This press release relates to Credit Ratings that have been published on AM Best’s website. For all rating information relating to the release and pertinent disclosures, including details of the office responsible for issuing each of the individual ratings referenced in this release, please see AM Best’s Recent Rating Activity web page. For additional information regarding the use and limitations of Credit Rating opinions, please view Guide to Best’s Credit Ratings. For information on the proper use of Best’s Credit Ratings, Best’s Performance Assessments, Best’s Preliminary Credit Assessments and AM Best press releases, please view Guide to Proper Use of Best’s Ratings & Assessments.

- Advertisement -

AM Best is a global credit rating agency, news publisher and data analytics provider specialising in the insurance industry. Headquartered in the United States, the company does business in over 100 countries with regional offices in London, Amsterdam, Dubai, Hong Kong, Singapore and Mexico City. For more information, visit www.ambest.com.

- Advertisement -

Copyright © 2025 by A.M. Best Rating Services, Inc. and/or its affiliates. ALL RIGHTS RESERVED.

Contacts

- Advertisement -

Patrick McCrystal
Financial Analyst
+44 20 3808 2988
patrick.mccrystal@ambest.com

- Advertisement -

Jessica Botelho-Young, CA
Director, Analytics
+44 20 7397 0310
jessica.botelho@ambest.com

Christopher Sharkey
Associate Director, Public Relations
+1 908 882 2310
christopher.sharkey@ambest.com

- Advertisement -

Al Slavin
Senior Public Relations Specialist
+1 908 882 2318
al.slavin@ambest.com

- Advertisement -
CBD Guangzhou 2025 Wraps Up with International Attendance Rising by 47.22%
DDB Worldwide Named Cannes Lions 2025 Network of the Year for the Second Time in Two Years
Primus Partners’ FY 2023-24 Report Reveals 44.8% Revenue Growth and Strategic Global Expansion Under the ‘CHETNA’ Framework
SERES Posts Robust H1 2025 Results: Revenue Hits CNY 62.4 Billion, Net Profit Up 81% to CNY 2.94 Billion, R&D Investment Soars nearly 155%
Zurich Kotak General Insurance marks its First Foundation Day with a Commitment to its Community and Commercial Insurance Launch
TAGGED: bassignedassignsbalancebestBusinesscompanycreditdavidshielddsicdsicsfinancialgoodgrouphighlyinsuranceissuerlondonbusinesslongtermltdnewspassportcardprofileratingratingsreinsurancesheetstrengthstrongwellwireamwtm
Share This Article
Facebook Copy Link Print
- Advertisement -

Your Trusted Source for Accurate and Timely Updates!

Our commitment to accuracy, impartiality, and delivering breaking news as it happens has earned us the trust of a vast audience. Stay ahead with real-time updates on the latest events, trends.
FacebookLike
XFollow
PinterestPin
InstagramFollow
YoutubeSubscribe
LinkedInFollow
MediumFollow

Most Selling Products

Top Picks, Trending Now – Discover the Best Sellers!
Tecno Camon 20 Premier 5G

Tecno Camon 20 Premier 5G

Dark Welkin | 8GB RAM + 512GB Storage (Expandable RAM up to 16GB) | Industry’s 1st 50MP RGBW-Pro Camera | Segment-First 108MP Ultra-Wide Macro Lens | 6.67" 120Hz 10-bit AMOLED In-Display

iQOO Z10 Lite 5G

iQOO Z10 Lite 5G

Titanium Blue | 6GB RAM + 128GB Storage | Dimensity 6300 5G with 433K+ AnTuTu Score | Robust 6000mAh Battery | IP64 Rated + Military-Grade Shock Resistance

OnePlus 13s

OnePlus 13s

Black Velvet | 12GB RAM + 256GB Storage | Flagship Snapdragon® 8 Elite Chipset | Exceptional Battery Life in a Compact Form | Lifetime Display Warranty Included

Samsung Galaxy A55 5G

Samsung Galaxy A55 5G

Awesome Iceblue | 8GB RAM + 256GB Storage | Premium Metal Frame | 50MP OIS Main Camera with Nightography | IP67 Water & Dust Resistance | Gorilla Glass Victus+ | sAMOLED Display with Vision Booster

You Might Also Like

Bybit DeFi Report: RWA and DEXs Thrive Despite Cooling Market Activity
Business

Bybit DeFi Report: RWA and DEXs Thrive Despite Cooling Market Activity

28/07/2025
Rosen Law Firm Urges Jasper Therapeutics, Inc. (NASDAQ: JSPR) Stockholders with Large Losses to Contact the Firm for Information About Their Rights
Business

Rosen Law Firm Urges Jasper Therapeutics, Inc. (NASDAQ: JSPR) Stockholders with Large Losses to Contact the Firm for Information About Their Rights

21/09/2025

Automobili Lamborghini captivates Sylt: performance meets art

28/07/2025

Heartwarming Global Response to Player Registration for Inaugural Canada Super 60 League

10/07/2025
Life Care News
Facebook Twitter Youtube Rss Medium

Life Care News:


We increase the awareness of millions of users through our news networks. We are one of the most trusted news networks in the world.

Top Categories
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Usefull Links
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Copyright © 2015 – 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Life Care NewsLife Care News
Copyright © 2015 - 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?