Sunday, 21 Sep 2025
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Subscribe
Life Care News
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
    NewsShow More
    Huawei and Industry Pioneers Unveil Over 30 Global Benchmark Showcases for Digital and Intelligent Transformation in the Data Communication Domain
    Huawei and Industry Pioneers Unveil Over 30 Global Benchmark Showcases for Digital and Intelligent Transformation in the Data Communication Domain
    21/09/2025
    India’s EV Charging Leaders Unite: ‘Indian Charge Point Operators Association’ (ICPOA) to Power the Next Wave of Electric Mobility
    India’s EV Charging Leaders Unite: ‘Indian Charge Point Operators Association’ (ICPOA) to Power the Next Wave of Electric Mobility
    21/09/2025
    Woxsen University Secures Top 5 Position in India in QS Business Masters Rankings 2025-26
    Woxsen University Secures Top 5 Position in India in QS Business Masters Rankings 2025-26
    20/09/2025
    Huawei Cloud: Empowering Customers to Succeed in Global Markets Through Continuous Innovation
    Huawei Cloud: Empowering Customers to Succeed in Global Markets Through Continuous Innovation
    20/09/2025
    Grvt Raises M to Pioneer Privacy-First Onchain Finance and Unlock Trillion-Dollar Markets
    Grvt Raises $19M to Pioneer Privacy-First Onchain Finance and Unlock Trillion-Dollar Markets
    19/09/2025
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
  • 🔥
  • news
  • global
  • june
  • Business
  • july
  • announced
  • today
  •  and
  •  the
  • Tech
Font ResizerAa
Life Care NewsLife Care News
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Search
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Follow US
© 2022 Foxiz News Network. Ruby Design Company. All Rights Reserved.
Tech

MiningCoop launches new Bitcoin & Dogecoin cloud mining contracts to earn passive cryptocurrency income without hardware

GlobeNews Wire
Last updated: 06/06/2025 1:52 AM
GlobeNews Wire
Share
8 Min Read
MiningCoop launches new Bitcoin & Dogecoin cloud mining contracts to earn passive cryptocurrency income without hardware
SHARE
MiningCoop launches new Bitcoin & Dogecoin cloud mining contracts to earn passive cryptocurrency income without hardware

London, June 05, 2025 (GLOBE NEWSWIRE) — According to Statista’s April 2025 report, global Bitcoin mining revenue is expected to exceed $50 billion this year, marking a historic high. As global demand for passive crypto income continues to surge, interest in Bitcoin (BTC) has skyrocketed. As a result, demand for legal, convenient, and high-return crypto investment platforms is at an all-time high.

As one of the most talked-about platforms in 2025, Miningcoop stands out with its cutting-edge AI hash rate optimization technology, green energy-powered data centers, and dual compliance in the UK and the US. It has become the most popular legal, secure, and hardware-free Bitcoin and Dogecoin cloud mining platform in 2025, offering AI-powered smart mining contracts with daily returns of up to 6.8%.

Fully Regulated and Globally Trusted: Miningcoop Sets a New Standard in BTC & DOGE Cloud Mining

As one of the most trusted cloud mining platforms globally in 2025, Miningcoop is registered in the UK and strictly adheres to international compliance standards. Its mining data centers are distributed across North America, Europe, and the Asia-Pacific region, all powered by 100% renewable energy, helping users achieve sustainable BTC and DOGE passive income.

Through seamless integration with top-tier ASIC miners (such as Antminer), and combined with advanced AI-powered hash rate allocation systems, Miningcoop achieves greater energy efficiency and higher daily mining returns, making it the go-to platform for cryptocurrency investors.

Cloud Mining Contracts Starting at $200, Daily Earnings up to $4,400

Miningcoop offers tailored, high-yield short-term mining contracts for cloud mining investors. These contracts require no hardware or maintenance, and guarantee daily profits:

The following chart illustrates the potential profit you can achieve.

Mining Model Contract Price ($) Daily Rate (%) Daily Earnings ($) Contract Duration (Days) Total Earnings ($)
iPollo V1 Ultra 200 4.00% 8.00 1 8.00
Goldshell Mini-DOGE III 500 3.20% 16.00 2 32.00
Bitmain Antminer S21 8,000 4.65% 372.00 6 2,232.00
Antminer S21 XP+ Hyd 30,000 6.80% 2,040.00 3 6,120.00
Antminer S21e XP Hyd 3U 55,000 8.00% 4,400.00 2 8,800.00

Withdrawals are supported in BTC, ETH, DOGE, or USDT. The minimum withdrawal amount is $200. All earnings are automatically calculated and credited daily.

Getting Started with Miningcoop Cloud Mining: Fast, Secure, and Zero Barriers to Passive Crypto Income

Even if you’ve never mined Bitcoin or Dogecoin before, Miningcoop’s onboarding process is extremely simple and intuitive. Users need no hardware or technical expertise, and just a few easy steps to start earning stable daily cloud mining profits:

Step 1: Register an Account
Visit Miningcoop.com and sign up with your email. Registration takes just one minute to access the AI-powered mining platform.

Step 2: Claim Your $100 Free Bitcoin Mining Trial Contract
Each new user receives a $100 trial contract upon registration. The contract lasts 1 day and is expected to generate up to $1.35 in free earnings.

Step 3: Choose a Suitable Mining Plan
The platform offers up to 8 high-yield mining contracts, supporting both BTC and DOGE. All contracts come with fixed durations, daily yield percentages, and automatic principal return mechanisms.

Step 4: Flexible Payments, Instant Launch
Supports multiple major cryptocurrencies including BTC, USDT, ETH, and DOGE. Once payment is confirmed, mining starts automatically—no manual operation required.

Step 5: Monitor Your Mining Earnings in Real-Time
Use the smart user dashboard to monitor daily earnings, contract progress, asset balances, and withdrawal records. The system automatically compounds your profits for maximum return.

Step 6: Withdraw or Reinvest for Higher Compounding Returns
When your account balance ≥ $200, you can apply for withdrawal anytime to your digital wallet, or choose to reinvest with one click to grow your profits through compounding.

Multi-Device Compatibility, Smooth Mobile Experience

Miningcoop is fully compatible with iOS and Android devices, and also supports desktop and mobile browser access. Whether you’re looking for an “Android Bitcoin cloud mining app” or an “iPhone DOGE cloud mining tool”, Miningcoop is the ideal choice.

Why Miningcoop Is More Trustworthy Than Other Crypto Mining Platforms

In 2025, although many platforms claim “high returns” in cloud mining, most suffer from technical opacity, exaggerated earnings, or lack of fund security. In contrast, Miningcoop has earned global user trust and continuous adoption thanks to its professional, compliant, and verifiable operational model.

  • 1. AI-Powered Hash Rate System with Transparent and Controllable Yields
    Miningcoop uses advanced AI algorithms to automatically allocate hash rate resources, combined with real-time blockchain data and market analysis, to dynamically optimize mining efficiency. All earnings are settled via smart contracts, ensuring that daily returns are real, transparent, and traceable.
  • 2. International Data Centers Ensure Stable Service
    Core cloud servers are located in green energy data centers across North America, Europe, and the Asia-Pacific region, ensuring 24/7 high-performance mining. No matter where you’re located—Asia, North America, or Africa—you’ll enjoy low-latency and efficient mining.
  • 3. Funds Safety First—No Involvement in High-Risk Trading
    Miningcoop promises: user funds will never be used for leveraged trading, DeFi lending, or derivatives speculation. All mining income comes from real mining pool computation, ensuring both principal safety and long-term growth.
  • 4. Blockchain Traceability + Auditable Mining Pool Data
    All mining machine operations, earning records, and blockchain outputs are 100% traceable and verifiable, allowing every user to clearly track the status of their investments. This high level of transparency is what distinguishes Miningcoop from other platforms.
  • 5. Rated the Most Trusted Free Bitcoin Cloud Mining Platform in 2025
    In addition to offering new users $100 free BTC cloud mining, Miningcoop has been selected by multiple independent crypto media outlets as the “Best Bitcoin Investment Platform of 2025” and the “Most Compliant & Trustworthy Cloud Mining Brand.”

Conclusion: In 2025, Start Your BTC & DOGE Journey Safely with Miningcoop

As the world’s most trusted AI-powered Bitcoin and Dogecoin cloud mining platform, Miningcoop offers investors from over 150 countries a new, efficient, and compliant way to earn passive income from BTC and DOGE. By leveraging AI-driven hash rate scheduling, green energy infrastructure, and international regulatory compliance, it perfectly balances security and high returns.

If you’re looking for a legal, safe, high-yield, and completely hardware-free way to invest in cryptocurrency—Miningcoop is your best starting point.

Visit miningcoop.com now to claim your $100 free mining trial and begin your journey of automated crypto asset growth!

Disclaimer: The information provided in this press release is not a solicitation for investment, nor is it intended as investment advice, financial advice, or trading advice. Cryptocurrency mining and staking involves risk. There is potential for loss of funds. It is strongly recommended you practice due diligence, including consultation with a professional financial advisor, before investing in or trading cryptocurrency and securities.

 
SAP Executives to Participate in Upcoming Investor Events in Q3 2025
Beach Cities Commercial Bank Announces Leadership Changes
Supersonik gets $5M from Andreessen Horowitz for its AI agent that runs live product demos
Global Healthcare Crisis: Legacy Systems Continue to Cause Pain for IT Decision Makers
Swift Navigation and Taiwan Mobile Partner to Unlock Autonomy and Automation with Centimeter-Accurate Positioning
TAGGED:accordingaprilbillionbitcoinbtccloudcontinuescryptodemandexceedexpectedglobalglobehighhistoricincomeinterestjunelondonmarkingminingnewswirepassiveplatformsreportrevenueskyrocketedstatistassurgeyear
Share This Article
Facebook Copy Link Print
- Advertisement -

Your Trusted Source for Accurate and Timely Updates!

Our commitment to accuracy, impartiality, and delivering breaking news as it happens has earned us the trust of a vast audience. Stay ahead with real-time updates on the latest events, trends.
FacebookLike
XFollow
PinterestPin
InstagramFollow
YoutubeSubscribe
LinkedInFollow
MediumFollow

Most Selling Products

Top Picks, Trending Now – Discover the Best Sellers!
Tecno Camon 20 Premier 5G

Tecno Camon 20 Premier 5G

Dark Welkin | 8GB RAM + 512GB Storage (Expandable RAM up to 16GB) | Industry’s 1st 50MP RGBW-Pro Camera | Segment-First 108MP Ultra-Wide Macro Lens | 6.67" 120Hz 10-bit AMOLED In-Display

iQOO Z10 Lite 5G

iQOO Z10 Lite 5G

Titanium Blue | 6GB RAM + 128GB Storage | Dimensity 6300 5G with 433K+ AnTuTu Score | Robust 6000mAh Battery | IP64 Rated + Military-Grade Shock Resistance

OnePlus 13s

OnePlus 13s

Black Velvet | 12GB RAM + 256GB Storage | Flagship Snapdragon® 8 Elite Chipset | Exceptional Battery Life in a Compact Form | Lifetime Display Warranty Included

Samsung Galaxy A55 5G

Samsung Galaxy A55 5G

Awesome Iceblue | 8GB RAM + 256GB Storage | Premium Metal Frame | 50MP OIS Main Camera with Nightography | IP67 Water & Dust Resistance | Gorilla Glass Victus+ | sAMOLED Display with Vision Booster

You Might Also Like

The All England Lawn Tennis Club and IBM Launch New AI Features for Real-Time Wimbledon Fan Engagement
Business

The All England Lawn Tennis Club and IBM Launch New AI Features for Real-Time Wimbledon Fan Engagement

17/06/2025
PotisEdge Secures Fifth Consecutive BNEF Tier 1 Ranking in Q3 2025
Entertainment

PotisEdge Secures Fifth Consecutive BNEF Tier 1 Ranking in Q3 2025

02/08/2025
Hoardsun Tech Group Chairman: Powering BRICS AI Growth through AI Optoelectronics
Tech

Hoardsun Tech Group Chairman: Powering BRICS AI Growth through AI Optoelectronics

24/07/2025
Aon confirmed as Official Partner of Scuderia Ferrari HP
Automobile

Aon confirmed as Official Partner of Scuderia Ferrari HP

04/09/2025
Life Care News
Facebook Twitter Youtube Rss Medium

Life Care News:


We increase the awareness of millions of users through our news networks. We are one of the most trusted news networks in the world.

Top Categories
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Usefull Links
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Copyright © 2015 – 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Life Care NewsLife Care News
Copyright © 2015 - 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?