Monday, 22 Sep 2025
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Subscribe
Life Care News
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
    NewsShow More
    Huawei and Industry Pioneers Unveil Over 30 Global Benchmark Showcases for Digital and Intelligent Transformation in the Data Communication Domain
    Huawei and Industry Pioneers Unveil Over 30 Global Benchmark Showcases for Digital and Intelligent Transformation in the Data Communication Domain
    21/09/2025
    India’s EV Charging Leaders Unite: ‘Indian Charge Point Operators Association’ (ICPOA) to Power the Next Wave of Electric Mobility
    India’s EV Charging Leaders Unite: ‘Indian Charge Point Operators Association’ (ICPOA) to Power the Next Wave of Electric Mobility
    21/09/2025
    Woxsen University Secures Top 5 Position in India in QS Business Masters Rankings 2025-26
    Woxsen University Secures Top 5 Position in India in QS Business Masters Rankings 2025-26
    20/09/2025
    Huawei Cloud: Empowering Customers to Succeed in Global Markets Through Continuous Innovation
    Huawei Cloud: Empowering Customers to Succeed in Global Markets Through Continuous Innovation
    20/09/2025
    Grvt Raises M to Pioneer Privacy-First Onchain Finance and Unlock Trillion-Dollar Markets
    Grvt Raises $19M to Pioneer Privacy-First Onchain Finance and Unlock Trillion-Dollar Markets
    19/09/2025
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
  • 🔥
  • news
  • global
  • june
  • Business
  • july
  • announced
  • today
  •  and
  •  the
  • Tech
Font ResizerAa
Life Care NewsLife Care News
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Search
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Follow US
© 2022 Foxiz News Network. Ruby Design Company. All Rights Reserved.
Tech

Spider Labs Rebrands as Marketing Security Platform to Strengthen Digital Risk Protection

GlobeNews Wire
Last updated: 19/09/2025 9:34 PM
GlobeNews Wire
Share
3 Min Read
Spider Labs Rebrands as Marketing Security Platform to Strengthen Digital Risk Protection
SHARE
Spider Labs Rebrands as Marketing Security Platform to Strengthen Digital Risk Protection

TOKYO, Sept. 19, 2025 (GLOBE NEWSWIRE) — Spider Labs Inc., provider of Spider AF, Japan’s No.1 ad fraud prevention tool in domestic adoption※, today announced a rebrand to position itself as a Marketing Security Platform. This evolution reflects the company’s mission to safeguard corporate marketing activities from increasingly complex fraud and digital risks.

Alongside the rebrand, Spider Labs has updated its corporate message from “Building a safer and happier future with automation” to “Building a safer and happier future with AI.” The shift highlights a transition from automation to AI-driven protection.

“With the rise of AI, new types of fraud are emerging and marketing risks grow more complex every day,” said Satoko Otsuki, CEO of Spider Labs. “Spider Labs is moving beyond reactive measures to deliver proactive protection that anticipates threats. Our new message reflects our vision of enabling businesses to face the future with confidence,” based on research conducted by the Japan Marketing Research Organization in June 2025.

Rising Marketing Risks

Today’s risks extend well beyond ad fraud to include fake leads, resale fraud, website tampering, data leakage, and reputational damage. According to Spider AF’s 2025 Ad Fraud White Paper, global advertisers lost an estimated $37.7 billion to ad fraud in 2024, with finance and telecom among the hardest hit sectors. These losses underscore the need for AI-powered defense strategies.

“Building a safer and happier future with AI” positions AI at the core of Spider Labs’ protective capabilities. Reflecting this vision, the company relaunched its corporate website (https://spider-labs.com), now organized by risk categories and enriched with reports, industry insights, and customer stories. The platform also introduces features supporting expansion into Europe and North America.

Spider Labs’ integrated solutions address multiple risks. PPC Protection prevents wasted spend from invalid clicks. Fake Lead Protection blocks fraudulent leads in real time. SiteScan detects tampering, data exfiltration, and script-based threats, protecting user experience and brand trust. Anti-Scalping prevents bot-driven fraudulent orders in e-commerce. These solutions are already trusted across finance, telecom, education, real estate, and e-commerce.

Spider Labs’ long-term strategy is built on four pillars: raising awareness of marketing fraud, strengthening AI-driven product capabilities, expanding globally through local partnerships, and collaborating with agencies to improve transparency. The company’s goal is to make Marketing Security as essential as auditing or compliance.

A photo accompanying this announcement is available at https://www.globenewswire.com/NewsRoom/AttachmentNg/587ad5fb-087b-4b71-b498-ab20119c0295

 

Telix Theranostic Programs and Satellite Symposia on Innovation in PSMA and CAIX Imaging Featured at SNMMI 2025
2025 U.S. Latino GDP Grows to $4 Trillion; The Worlds Fifth-Largest Economy is Now Projected to Surpass Japan and Germany by The End of The Decade
Orezone Announces Results of Meeting of Shareholders
KuCoin Pay Partners with BitTopup to Unlock More Real-World Utility for Crypto Users
adidas premieres new episode of docuseries featuring Ballon d’Or winner Aitana Bonmat told by her best friend Maria Rodriguez
TAGGED:adoptionannouncedautomationbuildingcomplexcorporatedigitaldomesticfraudfutureglobehappierincjapanslabsmarketingmessagenewsnewswireplatformpreventionprotectionproviderrebrandrebrandsreflectsResearchriskriskssafersecurityseptspiderstrengthentodaytokyotool
Share This Article
Facebook Copy Link Print
- Advertisement -

Your Trusted Source for Accurate and Timely Updates!

Our commitment to accuracy, impartiality, and delivering breaking news as it happens has earned us the trust of a vast audience. Stay ahead with real-time updates on the latest events, trends.
FacebookLike
XFollow
PinterestPin
InstagramFollow
YoutubeSubscribe
LinkedInFollow
MediumFollow

Most Selling Products

Top Picks, Trending Now – Discover the Best Sellers!
Tecno Camon 20 Premier 5G

Tecno Camon 20 Premier 5G

Dark Welkin | 8GB RAM + 512GB Storage (Expandable RAM up to 16GB) | Industry’s 1st 50MP RGBW-Pro Camera | Segment-First 108MP Ultra-Wide Macro Lens | 6.67" 120Hz 10-bit AMOLED In-Display

iQOO Z10 Lite 5G

iQOO Z10 Lite 5G

Titanium Blue | 6GB RAM + 128GB Storage | Dimensity 6300 5G with 433K+ AnTuTu Score | Robust 6000mAh Battery | IP64 Rated + Military-Grade Shock Resistance

OnePlus 13s

OnePlus 13s

Black Velvet | 12GB RAM + 256GB Storage | Flagship Snapdragon® 8 Elite Chipset | Exceptional Battery Life in a Compact Form | Lifetime Display Warranty Included

Samsung Galaxy A55 5G

Samsung Galaxy A55 5G

Awesome Iceblue | 8GB RAM + 256GB Storage | Premium Metal Frame | 50MP OIS Main Camera with Nightography | IP67 Water & Dust Resistance | Gorilla Glass Victus+ | sAMOLED Display with Vision Booster

You Might Also Like

GameChange Solar Rises to Third Globally and Second in U.S. Solar Tracker Market
Tech

GameChange Solar Rises to Third Globally and Second in U.S. Solar Tracker Market

13/08/2025
Coinzilla Drives 28M+ Impressions and 16K Conversions for Wild.io
Travel

Coinzilla Drives 28M+ Impressions and 16K Conversions for Wild.io

22/08/2025
METABORA GAMES Forms Strategic Web3 Game Partnership with Baligames
Business

METABORA GAMES Forms Strategic Web3 Game Partnership with Baligames

24/07/2025
World’s Best Glacier Photos Launch in Global “Walk of Water” Exhibition
Entertainment

World’s Best Glacier Photos Launch in Global “Walk of Water” Exhibition

03/07/2025
Life Care News
Facebook Twitter Youtube Rss Medium

Life Care News:


We increase the awareness of millions of users through our news networks. We are one of the most trusted news networks in the world.

Top Categories
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Usefull Links
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Copyright © 2015 – 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Life Care NewsLife Care News
Copyright © 2015 - 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?