Sunday, 20 Jul 2025
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Subscribe
Life Care News
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
    NewsShow More
    Talos to Acquire Coin Metrics Creating Industry’s First Integrated Data and Investment Management Platform for Digital Assets
    Talos to Acquire Coin Metrics Creating Industry’s First Integrated Data and Investment Management Platform for Digital Assets
    20/07/2025
    Euroclear reports robust H1 2025 results
    Euroclear reports robust H1 2025 results
    19/07/2025
    Synopsys Completes Acquisition of Ansys
    Synopsys Completes Acquisition of Ansys
    19/07/2025
    Woxsen University Ranks Among India’s Top Institutions in Architecture, Design, Business, and Technology in Outlook-ICARE Rankings 2025
    Woxsen University Ranks Among India’s Top Institutions in Architecture, Design, Business, and Technology in Outlook-ICARE Rankings 2025
    18/07/2025
    GMAC Announces New Board and Member School Additions, Amplifying Focus on Expanding Talent Pipeline
    GMAC Announces New Board and Member School Additions, Amplifying Focus on Expanding Talent Pipeline
    18/07/2025
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
  • 🔥
  • june
  • news
  • global
  • Business
  • july
  • today
  • announced
  • Tech
  • company
  • will
Font ResizerAa
Life Care NewsLife Care News
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Search
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Follow US
© 2022 Foxiz News Network. Ruby Design Company. All Rights Reserved.
Entertainment

A New Landmark for Fun: Timezone’s Largest Flagship Venue Opens at Inorbit Mall Malad

News Voir
Last updated: 02/07/2025 3:44 PM
News Voir
Share
5 Min Read
A New Landmark for Fun: Timezone’s Largest Flagship Venue Opens at Inorbit Mall Malad
SHARE
A New Landmark for Fun: Timezone’s Largest Flagship Venue Opens at Inorbit Mall Malad

Timezone, the leading brand in family and social entertainment from Australia, opens its largest, most immersive and experience-driven flagship venue in India, at Inorbit Mall Malad. This milestone comes over two decades after the brand’s first Indian venue debuted at the same location. Spanning an impressive 24,626 sqft across levels 1 and 2, this new destination is set to become Mumbai’s ultimate hub for play, food, and unforgettable celebrations.

- Advertisement -

Timezone unveils its new avatar, with 100+ games

- Advertisement -

The flagship Timezone venue is designed to set a new benchmark in experiential entertainment. Guests of all ages will discover a vibrant, dynamic environment packed with features crafted for fun and togetherness:

  • 6-Lane Social Bowling: Perfect for relaxed hangouts and friendly matches, no bowling shoes required!

  • Bumper Cars: Timeless excitement in a vibrant, safe arena for everyone to enjoy.

  • Laser Tag Arena: Fully immersive, interactive, and perfect for those seeking competitive thrills.

  • 100+ Exciting Games: Including fan favourites like Zap Cricket and VR Warship, alongside the latest releases.

  • India’s First Timezone Caf: A full-fledged, 60-seater caf serving scrumptious food, fun beverages, and premium treats.

  • 3 Party Rooms: Dedicated spaces suitable for celebrations of all kinds-birthdays, college reunions, corporate events, and private get-togethers. Each party is made hassle-free with dedicated hosts taking care of every detail, so guests can simply relax and enjoy the fun.

Where Fun, Food, and Connection Come Together

- Advertisement -

The Timezone Caf marks its debut as India’s first in-venue concept, offering a delectable menu designed for sharing and indulgence. With 26 fusion-inspired food items crafted to delight all age groups, the caf’s contemporary plating style encourages sharing with family and friends. Beverages range from handcrafted mocktails like the Japanese Mojito Magic and Kashmiri Rose Pulpy Lychee Cooler, to thick shakes, kid-friendly Crispy Caramel, and locally inspired Shikanji. Coffee lovers can enjoy freshly brewed coffee with a twist-Turkish Coffee and Black Forest options.

- Advertisement -

Food highlights include Green Harvest Pizza (light thin crust), Smoked BBQ Delight, Bombay Kheema Pav, Smoked Pulled Chicken Burger, Watermelon Feta Salad, and Lotus Biscoff Cheesecake. Every dish is made with premium, five-star grade imported ingredients, with no artificial colours or MSG.

Unforgettable Celebrations Made Simple

- Advertisement -

At Timezone Inorbit Mall Malad, every celebration is transformed into a special occasion. Whether it’s a child’s birthday, a college reunion, a corporate event, or a casual get-together, guests can expect a seamless, memorable experience. Timezone’s dedicated party hosts are on hand to coordinate everything from setup and catering to entertainment, ensuring that both organizers and guests can focus on enjoying the festivities. Each of the three party rooms is designed for comfort and fun, providing the perfect backdrop for photos, laughter, and shared moments. With customizable packages that fit any group size or theme, Timezone Inorbit Mall Malad delivers celebrations without any of the usual stress.

- Advertisement -

A Milestone for Mumbai and Timezone

Reflecting on this achievement, Abbas Jabalpurwala, CEO of Timezone India, shares, “It is serendipitous that our new flagship venue is located where the first Timezone in India was launched in 2004. This new venue, is a celebration of Timezone’s commitment to innovation and creating unforgettable experiences. With the largest, most immersive play environment in India, the debut of our first Timezone Caf, and three dedicated party rooms, we are redefining social entertainment for families, friends, and groups. Every element is designed to connect people, spark joy, and make every visit memorable, setting a new standard for entertainment in the country.”

- Advertisement -

Rajneesh Mahajan, CEO at Inorbit Malls India, adds: “This moment celebrates the strong partnership between Inorbit and Timezone spanning over two decades. From their first venue at our mall to today’s launch of their flagship venue, we’ve come full circle. It shows our commitment to growing together and always bringing fresh experiences to our customers.”

- Advertisement -

Plan Your Visit

Timezone Inorbit Mall Malad is now open to the public, welcoming guests from 11:00 AM to 10:00 PM, Monday to Sunday. Located on levels 1 & 2, Inorbit Mall Malad, Mumbai, the venue invites Mumbaikars to experience a new era of social entertainment.

- Advertisement -
Hungarian President visits Olympic House and Olympic Museum
IOC documentary series starring Simone Biles nominated for Primetime Emmy Award
ZTE’s “Signal Reach Program” Wins WSIS 2025 Champion Award
SafeTree Launches India’s First Maternity Insurance Tailored for IVF Couples with Just 7-Month Waiting Period
Blokees Becomes Exclusive Strategic Partner of “Journey of Light: A Glimpse into Ultraman’s 60th Anniversary” Exhibition
TAGGED: for newacrossaustraliabrandbrandscomesdebuteddecadesentertainmentexperiencedrivenfamilyfirstflagshipfunimmersiveimpressiveindia:indianinorbitlandmarklargestleadinglocationmaladmallmilestonenewsopenssocialspanningsqfttimezonetimezone’stwovenue
Share This Article
Facebook Copy Link Print
- Advertisement -

Your Trusted Source for Accurate and Timely Updates!

Our commitment to accuracy, impartiality, and delivering breaking news as it happens has earned us the trust of a vast audience. Stay ahead with real-time updates on the latest events, trends.
FacebookLike
XFollow
PinterestPin
InstagramFollow
YoutubeSubscribe
LinkedInFollow
MediumFollow

Most Selling Products

Top Picks, Trending Now – Discover the Best Sellers!
Tecno Camon 20 Premier 5G

Tecno Camon 20 Premier 5G

Dark Welkin | 8GB RAM + 512GB Storage (Expandable RAM up to 16GB) | Industry’s 1st 50MP RGBW-Pro Camera | Segment-First 108MP Ultra-Wide Macro Lens | 6.67" 120Hz 10-bit AMOLED In-Display

iQOO Z10 Lite 5G

iQOO Z10 Lite 5G

Titanium Blue | 6GB RAM + 128GB Storage | Dimensity 6300 5G with 433K+ AnTuTu Score | Robust 6000mAh Battery | IP64 Rated + Military-Grade Shock Resistance

OnePlus 13s

OnePlus 13s

Black Velvet | 12GB RAM + 256GB Storage | Flagship Snapdragon® 8 Elite Chipset | Exceptional Battery Life in a Compact Form | Lifetime Display Warranty Included

Samsung Galaxy A55 5G

Samsung Galaxy A55 5G

Awesome Iceblue | 8GB RAM + 256GB Storage | Premium Metal Frame | 50MP OIS Main Camera with Nightography | IP67 Water & Dust Resistance | Gorilla Glass Victus+ | sAMOLED Display with Vision Booster

You Might Also Like

HCLSoftware Launches Sovereign AI Aimed at Governments and Regulated Organizations Concerned with Their Data Privacy
Tech

HCLSoftware Launches Sovereign AI Aimed at Governments and Regulated Organizations Concerned with Their Data Privacy

12/07/2025
Sentient Digital, Inc. (SDi) Partners with Viasat to Support Korea Coast Guard Maritime Domain Awareness and Information Sharing Missions
Tech

Sentient Digital, Inc. (SDi) Partners with Viasat to Support Korea Coast Guard Maritime Domain Awareness and Information Sharing Missions

11/06/2025
Talos to Acquire Coin Metrics Creating Industry’s First Integrated Data and Investment Management Platform for Digital Assets
Food

Arkieva demand and production planning solution for Wells Enterprises recognized as Top Supply Chain Project

02/07/2025
From Commerce to Creativity: Piyush Goyal, Jonathan Reynolds, AR Rahman to headline IGF London 2025
News

From Commerce to Creativity: Piyush Goyal, Jonathan Reynolds, AR Rahman to headline IGF London 2025

17/06/2025
Life Care News
Facebook Twitter Youtube Rss Medium

Life Care News:


We increase the awareness of millions of users through our news networks. We are one of the most trusted news networks in the world.

Top Categories
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Usefull Links
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Copyright © 2015 – 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Life Care NewsLife Care News
Copyright © 2015 - 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?