Wednesday, 4 Mar 2026
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Subscribe
Life Care News
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
    NewsShow More
    World Customs Organization praises ‘e-commerce platform’ in trilingual report
    World Customs Organization praises ‘e-commerce platform’ in trilingual report
    31/12/2025
    Shri Acharya Devvrat, Governor of Gujarat, and Union Ministers Shri Kinjarapu Ram Mohan Naidu & Gajendra Singh Shekhawat Grace Namotsav at Sanskardham
    Shri Acharya Devvrat, Governor of Gujarat, and Union Ministers Shri Kinjarapu Ram Mohan Naidu & Gajendra Singh Shekhawat Grace Namotsav at Sanskardham
    31/12/2025
    International Forum “Problem-Solving City: Hong Kong as a Disputes Resolver”
    International Forum “Problem-Solving City: Hong Kong as a Disputes Resolver”
    28/12/2025
    Roca Group opens the Roca Delhi Gallery, its first in India, as part of its international network of design-led cultural spaces
    Roca Group opens the Roca Delhi Gallery, its first in India, as part of its international network of design-led cultural spaces
    28/12/2025
    Confidence Surges Among Small Enterprises Despite Global Headwinds, Reflecting India’s Strong Economic Momentum – ASSOCHAM Dun & Bradstreet Small Business Confidence Index
    Confidence Surges Among Small Enterprises Despite Global Headwinds, Reflecting India’s Strong Economic Momentum – ASSOCHAM Dun & Bradstreet Small Business Confidence Index
    27/12/2025
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
  • 🔥
  • news
  • global
  •  and
  •  the
  • announced
  • today
  • Business
  • Tech
  •  for
  • will
Font ResizerAa
Life Care NewsLife Care News
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Search
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Follow US
© 2022 Foxiz News Network. Ruby Design Company. All Rights Reserved.
Entertainment

A New Landmark for Fun: Timezone’s Largest Flagship Venue Opens at Inorbit Mall Malad

News Voir
Last updated: 02/07/2025 3:44 PM
News Voir
Share
5 Min Read
A New Landmark for Fun: Timezone’s Largest Flagship Venue Opens at Inorbit Mall Malad
SHARE
A New Landmark for Fun: Timezone’s Largest Flagship Venue Opens at Inorbit Mall Malad

Timezone, the leading brand in family and social entertainment from Australia, opens its largest, most immersive and experience-driven flagship venue in India, at Inorbit Mall Malad. This milestone comes over two decades after the brand’s first Indian venue debuted at the same location. Spanning an impressive 24,626 sqft across levels 1 and 2, this new destination is set to become Mumbai’s ultimate hub for play, food, and unforgettable celebrations.

- Advertisement -

Timezone unveils its new avatar, with 100+ games

- Advertisement -

The flagship Timezone venue is designed to set a new benchmark in experiential entertainment. Guests of all ages will discover a vibrant, dynamic environment packed with features crafted for fun and togetherness:

- Advertisement -
  • 6-Lane Social Bowling: Perfect for relaxed hangouts and friendly matches, no bowling shoes required!

  • Bumper Cars: Timeless excitement in a vibrant, safe arena for everyone to enjoy.

  • Laser Tag Arena: Fully immersive, interactive, and perfect for those seeking competitive thrills.

  • 100+ Exciting Games: Including fan favourites like Zap Cricket and VR Warship, alongside the latest releases.

  • India’s First Timezone Caf: A full-fledged, 60-seater caf serving scrumptious food, fun beverages, and premium treats.

  • 3 Party Rooms: Dedicated spaces suitable for celebrations of all kinds-birthdays, college reunions, corporate events, and private get-togethers. Each party is made hassle-free with dedicated hosts taking care of every detail, so guests can simply relax and enjoy the fun.

Where Fun, Food, and Connection Come Together

- Advertisement -

The Timezone Caf marks its debut as India’s first in-venue concept, offering a delectable menu designed for sharing and indulgence. With 26 fusion-inspired food items crafted to delight all age groups, the caf’s contemporary plating style encourages sharing with family and friends. Beverages range from handcrafted mocktails like the Japanese Mojito Magic and Kashmiri Rose Pulpy Lychee Cooler, to thick shakes, kid-friendly Crispy Caramel, and locally inspired Shikanji. Coffee lovers can enjoy freshly brewed coffee with a twist-Turkish Coffee and Black Forest options.

- Advertisement -

Food highlights include Green Harvest Pizza (light thin crust), Smoked BBQ Delight, Bombay Kheema Pav, Smoked Pulled Chicken Burger, Watermelon Feta Salad, and Lotus Biscoff Cheesecake. Every dish is made with premium, five-star grade imported ingredients, with no artificial colours or MSG.

- Advertisement -

Unforgettable Celebrations Made Simple

- Advertisement -

At Timezone Inorbit Mall Malad, every celebration is transformed into a special occasion. Whether it’s a child’s birthday, a college reunion, a corporate event, or a casual get-together, guests can expect a seamless, memorable experience. Timezone’s dedicated party hosts are on hand to coordinate everything from setup and catering to entertainment, ensuring that both organizers and guests can focus on enjoying the festivities. Each of the three party rooms is designed for comfort and fun, providing the perfect backdrop for photos, laughter, and shared moments. With customizable packages that fit any group size or theme, Timezone Inorbit Mall Malad delivers celebrations without any of the usual stress.

- Advertisement -

A Milestone for Mumbai and Timezone

- Advertisement -

Reflecting on this achievement, Abbas Jabalpurwala, CEO of Timezone India, shares, “It is serendipitous that our new flagship venue is located where the first Timezone in India was launched in 2004. This new venue, is a celebration of Timezone’s commitment to innovation and creating unforgettable experiences. With the largest, most immersive play environment in India, the debut of our first Timezone Caf, and three dedicated party rooms, we are redefining social entertainment for families, friends, and groups. Every element is designed to connect people, spark joy, and make every visit memorable, setting a new standard for entertainment in the country.”

- Advertisement -

Rajneesh Mahajan, CEO at Inorbit Malls India, adds: “This moment celebrates the strong partnership between Inorbit and Timezone spanning over two decades. From their first venue at our mall to today’s launch of their flagship venue, we’ve come full circle. It shows our commitment to growing together and always bringing fresh experiences to our customers.”

- Advertisement -

Plan Your Visit

- Advertisement -

Timezone Inorbit Mall Malad is now open to the public, welcoming guests from 11:00 AM to 10:00 PM, Monday to Sunday. Located on levels 1 & 2, Inorbit Mall Malad, Mumbai, the venue invites Mumbaikars to experience a new era of social entertainment.

- Advertisement -
Parimatch Sports Captures IPL Spirit with Game-Changing Outdoor Experience
Bybit x Santiment DeFi Report: Platform Tokens Shine As MNT Sees Over $1M Whale Transactions
After Women's Cricket Glory, Spotlight Turns to Women's Wrestling: Pro Wrestling League Set to Redefine the Future
Brazil’s Ministry of Education, UNESCO, and Huawei Launch Open Schools Digital Transformation Projects in Bahia and Par
Fermenta Board Approves INR 110 Crore Capex at Dahej for Plant-based Vitamin D3, Green Chemistry Enzyme, and Vitamin D3 Derivatives
TAGGED: for newacrossaustraliabrandbrandscomesdebuteddecadesentertainmentexperiencedrivenfamilyfirstflagshipfunimmersiveimpressiveindia:indianinorbitlandmarklargestleadinglocationmaladmallmilestonenewsopenssocialspanningsqfttimezonetimezone’stwovenue
Share This Article
Facebook Copy Link Print
- Advertisement -

Your Trusted Source for Accurate and Timely Updates!

Our commitment to accuracy, impartiality, and delivering breaking news as it happens has earned us the trust of a vast audience. Stay ahead with real-time updates on the latest events, trends.
FacebookLike
XFollow
PinterestPin
InstagramFollow
YoutubeSubscribe
LinkedInFollow
MediumFollow

Most Selling Products

Top Picks, Trending Now – Discover the Best Sellers!
Tecno Camon 20 Premier 5G

Tecno Camon 20 Premier 5G

Dark Welkin | 8GB RAM + 512GB Storage (Expandable RAM up to 16GB) | Industry’s 1st 50MP RGBW-Pro Camera | Segment-First 108MP Ultra-Wide Macro Lens | 6.67" 120Hz 10-bit AMOLED In-Display

iQOO Z10 Lite 5G

iQOO Z10 Lite 5G

Titanium Blue | 6GB RAM + 128GB Storage | Dimensity 6300 5G with 433K+ AnTuTu Score | Robust 6000mAh Battery | IP64 Rated + Military-Grade Shock Resistance

OnePlus 13s

OnePlus 13s

Black Velvet | 12GB RAM + 256GB Storage | Flagship Snapdragon® 8 Elite Chipset | Exceptional Battery Life in a Compact Form | Lifetime Display Warranty Included

Samsung Galaxy A55 5G

Samsung Galaxy A55 5G

Awesome Iceblue | 8GB RAM + 256GB Storage | Premium Metal Frame | 50MP OIS Main Camera with Nightography | IP67 Water & Dust Resistance | Gorilla Glass Victus+ | sAMOLED Display with Vision Booster

You Might Also Like

Vantage Shines at Money Expo Colombia 2025 with Industry Recognition and Dynamic Engagement
Business

Vantage Shines at Money Expo Colombia 2025 with Industry Recognition and Dynamic Engagement

04/07/2025
Project Eleven to Advance Post-Quantum Security for the Solana Network
Business

Project Eleven to Advance Post-Quantum Security for the Solana Network

17/12/2025
Aurora Spine Announces Launch of its DEXA-L Anterior Lumbar Interbody Fusion Device
Health

Aurora Spine Announces Launch of its DEXA-L Anterior Lumbar Interbody Fusion Device

18/09/2025

Spencer’s Tunick art installation “Retrato Alhambra1925” highlights Cervezas Alhambra’s 100th anniversary of its Andalusian roots

20/09/2025
Life Care News
Facebook Twitter Youtube Rss Medium

Life Care News:


We increase the awareness of millions of users through our news networks. We are one of the most trusted news networks in the world.

Top Categories
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Usefull Links
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Copyright © 2015 – 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Life Care NewsLife Care News
Copyright © 2015 - 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?