Wednesday, 8 Oct 2025
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Subscribe
Life Care News
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
    NewsShow More
    Nobel Prize 2025 in Medicine: Three Scientists Who Changed the Future of Immunology
    Nobel Prize 2025 in Medicine: Three Scientists Who Changed the Future of Immunology
    08/10/2025
    नोबेल पुरस्कार 2025 – मेडिसिन कैटेगरी में तीन वैज्ञानिकों की शानदार जीत!
    नोबेल पुरस्कार 2025 – मेडिसिन कैटेगरी में तीन वैज्ञानिकों की शानदार जीत!
    08/10/2025
    Comviva Fintech Platforms Hits  Billion Daily Transaction Milestone, Strengthening its Global Fintech Dominance
    Comviva Fintech Platforms Hits $1 Billion Daily Transaction Milestone, Strengthening its Global Fintech Dominance
    08/10/2025
    Financing Asia’s Future: IJGlobal’s Infrastructure Finance Forum (IFF): Asia 2025 comes to Singapore
    Financing Asia’s Future: IJGlobal’s Infrastructure Finance Forum (IFF): Asia 2025 comes to Singapore
    08/10/2025
    Newmark Acquires Leading Real Estate Consulting and Managed Services Firm, RealFoundations
    Newmark Acquires Leading Real Estate Consulting and Managed Services Firm, RealFoundations
    08/10/2025
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
  • 🔥
  • news
  • global
  • Business
  • june
  • announced
  • today
  •  and
  • july
  •  the
  • company
Font ResizerAa
Life Care NewsLife Care News
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Search
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Follow US
© 2022 Foxiz News Network. Ruby Design Company. All Rights Reserved.
Tech

Aisera Recognized as a Leader in the IDC MarketScape for Worldwide General-Purpose Conversational AI Platforms

GlobeNews Wire
Last updated: 07/10/2025 8:32 PM
GlobeNews Wire
Share
6 Min Read
Aisera Recognized as a Leader in the IDC MarketScape for Worldwide General-Purpose Conversational AI Platforms
SHARE
Aisera Recognized as a Leader in the IDC MarketScape for Worldwide General-Purpose Conversational AI Platforms

October 07, 2025 11:00 ET  | Source: Aisera

SANTA CLARA, Calif., Oct. 07, 2025 (GLOBE NEWSWIRE) — Aisera, a leading provider of agentic AI for the enterprise, announced today that it has been named a Leader in the IDC MarketScape for Worldwide General-Purpose Conversational AI Platforms 2025 Vendor Assessment (doc #US52972625, September 2025). Vendors were evaluated based on product capabilities, customer adoption, innovation strategy, deployment flexibility, and breadth of use case support.

The shifting landscape of enterprise conversational AI
Enterprise AI has rapidly evolved from Conversational AI (CAI) to Generative AI to Agentic AI in a matter of a few years. Despite this rapid evolution in types of AI, conversational AI has remained at the core of AI applications due to the human-centered nature of enterprise functions, especially those that focus on employee and customer experiences.

According to the IDC MarketScape, “As AI innovations rapidly advance the capabilities and expectations for CAI platforms, technology and business leaders must keep a close eye on this shifting landscape, work to cut through the hype, and determine which conversational AI use cases and features are the most important for their organization. They must do this with an eye on reducing IT costs while also preparing the business and its technology for greater use of AI.”

Aisera strengths driving enterprise impact
IDC MarketScape has identified two specific areas of strengths for Aisera:

  1. Balance of universal and domain-specific AI: Aisera’s industry/domain-specific approach to conversational AI continues to be a strength in 2025, now including the ability to create or enhance enterprise taxonomies, ontologies, or other knowledge models with generative AI. However, its customers also chose Aisera for its ability to create a “universal bot” that can manage workflows across a variety of other AI bots, assistants, and agents.
  2. Customer partnership model: Aisera’s customers find the vendor to be a strong partner in enterprise-wide AI, helping to smooth the way through challenges such as multisystem integration and customization with off-the-shelf solutions and low-code tools while also being responsive to evolving customer needs. Customers and prospects view Aisera as a strong technical innovator that aligns its research and development (R&D) to their business needs.

“Aisera’s position as a leader in Conversational AI by IDC for the second consecutive year is the validation of our dual commitment to innovation and customer success – blending universal AI capabilities with deep domain expertise, and pairing cutting-edge technology with a white-glove partnership model,” said Abhi Maheshwari, CEO of Aisera. “As enterprises navigate the complexities of multi-system environments and rapidly expanding agent-based orchestration, Aisera is uniquely positioned to deliver both the universal intelligence to unify disparate channels of communication and the generative AI depth to enrich enterprise taxonomies and ontologies. Our mission remains clear: to make AI a trusted, transformational force across every layer of the modern enterprise.”

Purpose-built AI for enterprise scale
Aisera continues to evolve its AI agent platform with the recent introduction of A2A, MCP, and AGNTCY, the latest open standards that are becoming table stakes for enterprise AI agent platforms.

According to the IDC MarketScape, “While protocols such as agent to agent (A2A) and MCP are still emerging, it will be important for buyers to understand potential vendors’ strategies for key issues such as interoperability, data connectivity, and data privacy/security in a multi-agent setting.”

Aisera reports that its customers, many of them large Global 2000 enterprises, achieve on average over 75% auto-resolution rates for issues and queries, 78% increase in employee satisfaction, and 55% increase in productivity with operational cost reductions reaching 63% year over year.

Download the IDC MarketScape: Worldwide General-Purpose Conversational AI Platforms excerpt here.

About IDC MarketScape

IDC MarketScape vendor assessment model is designed to provide an overview of the competitive fitness of technology and service suppliers in a given market. The research utilizes a rigorous scoring methodology based on both qualitative and quantitative criteria that results in a single graphical illustration of each supplier’s position within a given market. IDC MarketScape provides a clear framework in which the product and service offerings, capabilities and strategies, and current and future market success factors of technology suppliers can be meaningfully compared. The framework also provides technology buyers with a 360-degree assessment of the strengths and weaknesses of current and prospective suppliers.

About Aisera

Aisera enables businesses to deliver transformative work experiences, boost employee productivity, and reduce operational costs with its award-winning AI agent platform. Aisera has been recognized as a leader in the market by top industry analysts including Gartner, Forrester, and IDC in conversational, generative, and agentic AI for enterprises.

Founded in 2017, Aisera is backed by top-tier investors such as Goldman Sachs, Menlo Ventures, True Ventures, Norwest, Thoma Bravo, Cisco Ventures, and Workday Ventures. Fortune 500 enterprises, including Adobe, Workday, T-Mobile, Gilead Sciences, Amgen, and BNSF Railway, rely on Aisera’s products and solutions to deliver transformative results.

Headquartered in Santa Clara, California, Aisera operates globally across the USA, Greece, India, Canada, and the UK.

To learn more or schedule a live demo, contact: info@aisera.com.

IOC Executive Board approves 13 athletes changes of sporting nationality for the Milano Cortina 2026 Olympic Winter Games
An Introduction to iFORGED: How Srixon Improved Feel for New ZXi Lineup
CARD91 Launches AI-Powered Merchant Verification and Classification Suite to Simplify and Secure Onboarding
Track3D Secures $10 Mn Series A to Transform Construction Monitoring from Ironspring Ventures and Zacua Ventures
HDFC Life Celebrates 25th AGM; Chairman Keki Mistry Highlights Industry Potential and Strong Company Performance
TAGGED: for theaiseraconversationalgeneral-purposeidcleadermarketscapenewsplatformsrecognizedworldwide
Share This Article
Facebook Copy Link Print
- Advertisement -

Your Trusted Source for Accurate and Timely Updates!

Our commitment to accuracy, impartiality, and delivering breaking news as it happens has earned us the trust of a vast audience. Stay ahead with real-time updates on the latest events, trends.
FacebookLike
XFollow
PinterestPin
InstagramFollow
YoutubeSubscribe
LinkedInFollow
MediumFollow

Most Selling Products

Top Picks, Trending Now – Discover the Best Sellers!
Tecno Camon 20 Premier 5G

Tecno Camon 20 Premier 5G

Dark Welkin | 8GB RAM + 512GB Storage (Expandable RAM up to 16GB) | Industry’s 1st 50MP RGBW-Pro Camera | Segment-First 108MP Ultra-Wide Macro Lens | 6.67" 120Hz 10-bit AMOLED In-Display

iQOO Z10 Lite 5G

iQOO Z10 Lite 5G

Titanium Blue | 6GB RAM + 128GB Storage | Dimensity 6300 5G with 433K+ AnTuTu Score | Robust 6000mAh Battery | IP64 Rated + Military-Grade Shock Resistance

OnePlus 13s

OnePlus 13s

Black Velvet | 12GB RAM + 256GB Storage | Flagship Snapdragon® 8 Elite Chipset | Exceptional Battery Life in a Compact Form | Lifetime Display Warranty Included

Samsung Galaxy A55 5G

Samsung Galaxy A55 5G

Awesome Iceblue | 8GB RAM + 256GB Storage | Premium Metal Frame | 50MP OIS Main Camera with Nightography | IP67 Water & Dust Resistance | Gorilla Glass Victus+ | sAMOLED Display with Vision Booster

You Might Also Like

Elmo Motion Control Showcases New Technologies and Aims to Grow Distributor Partnerships in India at Automation Expo 2025
Automobile

Elmo Motion Control Showcases New Technologies and Aims to Grow Distributor Partnerships in India at Automation Expo 2025

08/08/2025
Metabolon Partners with China Kadoorie Biobank to Advance Precision Health
Health

Metabolon Partners with China Kadoorie Biobank to Advance Precision Health

14/09/2025
Hisense Unveils RGB-MiniLED Display Breakthroughs and Immersive Sound Innovations at IFA 2025
Food

Hisense Unveils RGB-MiniLED Display Breakthroughs and Immersive Sound Innovations at IFA 2025

06/09/2025
Patton Unveils Second-Generation, US-Made, Commercial-Grade, FIPS-140 Ultra-Secure SIP Phone with Enhanced NG911 Compliance
Tech

Patton Unveils Second-Generation, US-Made, Commercial-Grade, FIPS-140 Ultra-Secure SIP Phone with Enhanced NG911 Compliance

13/06/2025
Life Care News
Facebook Twitter Youtube Rss Medium

Life Care News:


We increase the awareness of millions of users through our news networks. We are one of the most trusted news networks in the world.

Top Categories
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Usefull Links
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Copyright © 2015 – 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Life Care NewsLife Care News
Copyright © 2015 - 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?