Wednesday, 18 Feb 2026
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Subscribe
Life Care News
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
    NewsShow More
    World Customs Organization praises ‘e-commerce platform’ in trilingual report
    World Customs Organization praises ‘e-commerce platform’ in trilingual report
    31/12/2025
    Shri Acharya Devvrat, Governor of Gujarat, and Union Ministers Shri Kinjarapu Ram Mohan Naidu & Gajendra Singh Shekhawat Grace Namotsav at Sanskardham
    Shri Acharya Devvrat, Governor of Gujarat, and Union Ministers Shri Kinjarapu Ram Mohan Naidu & Gajendra Singh Shekhawat Grace Namotsav at Sanskardham
    31/12/2025
    International Forum “Problem-Solving City: Hong Kong as a Disputes Resolver”
    International Forum “Problem-Solving City: Hong Kong as a Disputes Resolver”
    28/12/2025
    Roca Group opens the Roca Delhi Gallery, its first in India, as part of its international network of design-led cultural spaces
    Roca Group opens the Roca Delhi Gallery, its first in India, as part of its international network of design-led cultural spaces
    28/12/2025
    Confidence Surges Among Small Enterprises Despite Global Headwinds, Reflecting India’s Strong Economic Momentum – ASSOCHAM Dun & Bradstreet Small Business Confidence Index
    Confidence Surges Among Small Enterprises Despite Global Headwinds, Reflecting India’s Strong Economic Momentum – ASSOCHAM Dun & Bradstreet Small Business Confidence Index
    27/12/2025
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
  • 🔥
  • news
  • global
  •  and
  •  the
  • announced
  • today
  • Business
  • Tech
  •  for
  • will
Font ResizerAa
Life Care NewsLife Care News
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Search
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Follow US
© 2022 Foxiz News Network. Ruby Design Company. All Rights Reserved.
News

Bybit x FXStreet TradFi Report: Japan’s Historic Leadership Shift Sparks Nikkei Rally and Yen Weakness

PRNW Agency
Last updated: 11/10/2025 7:31 PM
PRNW Agency
Share
4 Min Read
Bybit x FXStreet TradFi Report: Japan’s Historic Leadership Shift Sparks Nikkei Rally and Yen Weakness
SHARE
Bybit x FXStreet TradFi Report: Japan’s Historic Leadership Shift Sparks Nikkei Rally and Yen Weakness

DUBAI, UAE , Oct. 10, 2025 /PRNewswire/ — Bybit, the world’s second-largest cryptocurrency exchange by trading volume, has released a new Bybit x FXStreet TradFi Report, analyzing Japan’s unprecedented political transition and its sweeping effects on global markets.

- Advertisement -

The report spotlights the election of Sanae Takaichi, who is likely to become Japan’s first female prime minister, a milestone that has reshaped investor sentiment and jolted currency and equity markets.

- Advertisement -

Following her victory in the Liberal Democratic Party’s leadership race, the yen plunged to historic lows against the euro and broke past 150 versus the U.S. dollar, while the Nikkei 225 rose 4.8 percent to a new all-time high, approaching the 48,000 mark.

- Advertisement -

Analysts note that Takaichi’s pro-growth, stimulus-friendly platform has altered expectations for the Bank of Japan’s monetary policy. Betting markets, which had placed a 60 percent chance on an October hike, quickly revised their expectations downward to 24 percent. Markets are now pricing in a likely hike to 0.75 percent in December. This adjustment has reinforced yen weakness and bolstered equity momentum.

- Advertisement -

Key highlights:

- Advertisement -
  • Political milestone: Sanae Takaichi becomes Japan’s first female prime minister.
  • Currency markets: Yen hits record lows against the euro; USD/JPY breaks the 150 threshold.
  • Policy shift: Expectations for a Bank of Japan rate hike postponed to December.
  • Equities rally: Nikkei 225 could surge toward 50,000, with the index already approaching 48,000 on stimulus hopes and continued low interest rates.
  • Near-term catalysts: October’s parliamentary confirmation vote and the BOJ’s policy meeting loom large.

The report underscores the heightened volatility in traditional finance and crypto markets as traders recalibrate strategies around Japan’s evolving economic outlook. With the yen under pressure and equities buoyed by stimulus hopes, Japan has returned to the center of global macro discussions.

- Advertisement -

The full Bybit x FXStreet TradFi Report is available now on Bybit’s official platform, offering traders in-depth analysis, technical insights, and forward-looking market perspectives. Bybit’s MetaTrader 5 (MT5) platform is also noted in the report as a venue for navigating FX market movements during this period of volatility.

- Advertisement -

#Bybit / #TheCryptoArk /#BybitResearch

- Advertisement -

About Bybit

- Advertisement -

Bybit is the world’s second-largest cryptocurrency exchange by trading volume, serving a global community of over 70 million users. Founded in 2018, Bybit is redefining openness in the decentralized world by creating a simpler, open and equal ecosystem for everyone. With a strong focus on Web3, Bybit partners strategically with leading blockchain protocols to provide robust infrastructure and drive on-chain innovation. Renowned for its secure custody, diverse marketplaces, intuitive user experience, and advanced blockchain tools, Bybit bridges the gap between TradFi and DeFi, empowering builders, creators, and enthusiasts to unlock the full potential of Web3. Discover the future of decentralized finance at Bybit.com.

- Advertisement -

For more details about Bybit, please visit Bybit Press
For media inquiries, please contact: media@bybit.com
For updates, please follow: Bybit’s Communities and Social Media

- Advertisement -


Discord
 | Facebook | Instagram | LinkedIn | Reddit | Telegram | TikTok | X | Youtube

- Advertisement -

Photo – https://mma.prnewswire.com/media/2793225/Source_TradingView.jpg

Logo – https://mma.prnewswire.com/media/2267288/Logo.jpg

- Advertisement -

View original content:https://www.prnewswire.co.uk/news-releases/bybit-x-fxstreet-tradfi-report-japans-historic-leadership-shift-sparks-nikkei-rally-and-yen-weakness-302580675.html

- Advertisement -
Lodha earns Prestigious ‘Great Place To Work’ Recognition for Exemplary Workplace Culture
NYSE Content advisory: Pre-Market update + Trump announces 50% levy on copper imports
Wingderm Strengthens Presence in Asia at IMCAS Asia 2025
Fermenta Board Approves Sale of Environmental Solutions Business to Wholly Owned Subsidiary
TUMI DEBUTS “ICONS TESTED” CAMPAIGN STARRING GLOBAL BRAND AMBASSADORS LANDO NORRIS AND NELLY KORDA
TAGGED: andanalyzingbecomebybitcryptocurrencydubaieffectselectionexchangefirstfxstreetglobalhistoricjapansleadershiplikelymarketsnewsnikkeioctpoliticalrallyreleasedreportsanaesecondlargestshiftsparksspotlightssweepingtakaichitradfitradingtransitionuaeunprecedentedvolumeweaknessworldsyen
Share This Article
Facebook Copy Link Print
- Advertisement -

Your Trusted Source for Accurate and Timely Updates!

Our commitment to accuracy, impartiality, and delivering breaking news as it happens has earned us the trust of a vast audience. Stay ahead with real-time updates on the latest events, trends.
FacebookLike
XFollow
PinterestPin
InstagramFollow
YoutubeSubscribe
LinkedInFollow
MediumFollow

Most Selling Products

Top Picks, Trending Now – Discover the Best Sellers!
Tecno Camon 20 Premier 5G

Tecno Camon 20 Premier 5G

Dark Welkin | 8GB RAM + 512GB Storage (Expandable RAM up to 16GB) | Industry’s 1st 50MP RGBW-Pro Camera | Segment-First 108MP Ultra-Wide Macro Lens | 6.67" 120Hz 10-bit AMOLED In-Display

iQOO Z10 Lite 5G

iQOO Z10 Lite 5G

Titanium Blue | 6GB RAM + 128GB Storage | Dimensity 6300 5G with 433K+ AnTuTu Score | Robust 6000mAh Battery | IP64 Rated + Military-Grade Shock Resistance

OnePlus 13s

OnePlus 13s

Black Velvet | 12GB RAM + 256GB Storage | Flagship Snapdragon® 8 Elite Chipset | Exceptional Battery Life in a Compact Form | Lifetime Display Warranty Included

Samsung Galaxy A55 5G

Samsung Galaxy A55 5G

Awesome Iceblue | 8GB RAM + 256GB Storage | Premium Metal Frame | 50MP OIS Main Camera with Nightography | IP67 Water & Dust Resistance | Gorilla Glass Victus+ | sAMOLED Display with Vision Booster

You Might Also Like

ArkBio Initiates Phase II Clinical Trial of AK0610, a Preventive Monoclonal Antibody for Respiratory Syncytial Virus Infection
Health

ArkBio Initiates Phase II Clinical Trial of AK0610, a Preventive Monoclonal Antibody for Respiratory Syncytial Virus Infection

31/10/2025

Nobu Manchester breaks ground as Robert De Niro visits Manchester with Salboy

20/12/2025

Kia EV2 World Premiere confirmed for Brussels Motor Show 2026

02/12/2025

March Mania in Las Vegas is a Slam Dunk with Live Entertainment, CantMiss Watch Parties and Game Day Culinary Delicacies

05/07/2025
Life Care News
Facebook Twitter Youtube Rss Medium

Life Care News:


We increase the awareness of millions of users through our news networks. We are one of the most trusted news networks in the world.

Top Categories
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Usefull Links
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Copyright © 2015 – 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Life Care NewsLife Care News
Copyright © 2015 - 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?