Monday, 1 Sep 2025
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Subscribe
Life Care News
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
    NewsShow More
    Nippon Life India Asset Management (NAM India) Strengthening Indo-Japan Ties: Sundeep Sikka
    Nippon Life India Asset Management (NAM India) Strengthening Indo-Japan Ties: Sundeep Sikka
    01/09/2025
    SPJIMR WISE Tech leads dialogue on sustainable consumption
    SPJIMR WISE Tech leads dialogue on sustainable consumption
    01/09/2025
    Best Ally in the fight against corruption
    Best Ally in the fight against corruption
    31/08/2025
    SANY Reports Strong First Half 2025 Results, Delivering Profitable Growth
    SANY Reports Strong First Half 2025 Results, Delivering Profitable Growth
    31/08/2025
    Bybit x Santiment DeFi Report: Platform Tokens Shine As MNT Sees Over M Whale Transactions
    Bybit x Santiment DeFi Report: Platform Tokens Shine As MNT Sees Over $1M Whale Transactions
    30/08/2025
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
  • 🔥
  • news
  • june
  • global
  • Business
  • july
  • today
  • announced
  • aug
  • company
  • Tech
Font ResizerAa
Life Care NewsLife Care News
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Search
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Follow US
© 2022 Foxiz News Network. Ruby Design Company. All Rights Reserved.
Tech

EMCD Unveils Spotlight Grant Worth $25,000 in Listing & Marketing for Promising Web3 Projects

GlobeNews Wire
Last updated: 12/06/2025 7:54 AM
GlobeNews Wire
Share
3 Min Read
EMCD Unveils Spotlight Grant Worth ,000 in Listing & Marketing for Promising Web3 Projects
SHARE
EMCD Unveils Spotlight Grant Worth ,000 in Listing & Marketing for Promising Web3 Projects

Victoria, Seychelles , June 11, 2025 (GLOBE NEWSWIRE) — Global crypto-fintech platform EMCD is proud to launch Spotlight Grant, a new initiative aimed at accelerating high-potential Web3 projects. The grand prize includes a free EMCD listing and a $25,000 marketing package, while two runners-up will receive a 50% discount on the Spotlight program.

 The program targets Web3 ventures with a live token, looking for possibilities of expansion. Eligible projects span DeFi, GameFi, Layer 2, and payment infrastructures, seeking growth across international markets.

“We are building an ecosystem where projects don’t just launch — they go global. Spotlight Grant isn’t about one-off hype; it’s structured support: from listing to community engagement,” says Michael Jerlis, CEO of EMCD. “We’re looking for long-term builders, not short-term buzz.”

Participating teams will submit a simple online application, and post a tweet using the hashtag #EMCDSpotlightGrant.

All submissions will be reviewed, with ten shortlisted based on alignment with EMCD’s infrastructure, community size, and market cap. The final winner will be selected by an EMCD committee. The winner and two finalists will be announced live during AMA, followed by coordinated announcements across all of EMCD’s channels.

Spotlight Grant is part of EMCD’s broader mission to build a developer- and founder-friendly ecosystem in Web3, where access to resources, infrastructure, and visibility is no longer limited to the top 1% of projects. The program reflects EMCD’s belief that promising ideas deserve more than short-term hype — they need long-term partners, trusted platforms, and communities that are ready to grow with them.

About EMCD:

EMCD is a comprehensive crypto fintech ecosystem, combining top‑7 global mining pool status, P2P exchange, multi-currency wallet, and the Coinhold savings service with up to 14% annual yield In 2024, EMCD mined over 51,709 coins, onboarded 100,000+ new users across P2P and wallet services, and surpassed 300,000 active users globally.

EMCD — the platform where everything is easy, from mining to trading to scaling. 

Disclaimer: The information provided in this press release is not a solicitation for investment, nor is it intended as investment advice, financial advice, or trading advice. It is strongly recommended you practice due diligence, including consultation with a professional financial advisor, before investing in or trading cryptocurrency and securities.



Replimune Announces Inducement Grants Under Nasdaq Listing Rule 5635(c)(4)
Nixol Capsules Launch in the UK: A Natural Path to Weight Management and Metabolic Support
Pragati: AI for Impact Convening by Meta and The/Nudge Institute advances India’s Inclusive AI Agenda
Cambrex Expands Peptide Manufacturing Capabilities in Waltham, Massachusetts
Aon appoints Andy Marcell to serve as CEO of Global Solutions
TAGGED:a $a freeacceleratingaimedcryptofintechemcdemcd isglobalglobegrandgranthighpotentialincludesinitiativejunelaunch spotlightlisting andmarketingnewswirepackageplatformprizeprogramprojectsproudrunnersupseychellestwovictoriaweb
Share This Article
Facebook Copy Link Print
- Advertisement -

Your Trusted Source for Accurate and Timely Updates!

Our commitment to accuracy, impartiality, and delivering breaking news as it happens has earned us the trust of a vast audience. Stay ahead with real-time updates on the latest events, trends.
FacebookLike
XFollow
PinterestPin
InstagramFollow
YoutubeSubscribe
LinkedInFollow
MediumFollow

Most Selling Products

Top Picks, Trending Now – Discover the Best Sellers!
Tecno Camon 20 Premier 5G

Tecno Camon 20 Premier 5G

Dark Welkin | 8GB RAM + 512GB Storage (Expandable RAM up to 16GB) | Industry’s 1st 50MP RGBW-Pro Camera | Segment-First 108MP Ultra-Wide Macro Lens | 6.67" 120Hz 10-bit AMOLED In-Display

iQOO Z10 Lite 5G

iQOO Z10 Lite 5G

Titanium Blue | 6GB RAM + 128GB Storage | Dimensity 6300 5G with 433K+ AnTuTu Score | Robust 6000mAh Battery | IP64 Rated + Military-Grade Shock Resistance

OnePlus 13s

OnePlus 13s

Black Velvet | 12GB RAM + 256GB Storage | Flagship Snapdragon® 8 Elite Chipset | Exceptional Battery Life in a Compact Form | Lifetime Display Warranty Included

Samsung Galaxy A55 5G

Samsung Galaxy A55 5G

Awesome Iceblue | 8GB RAM + 256GB Storage | Premium Metal Frame | 50MP OIS Main Camera with Nightography | IP67 Water & Dust Resistance | Gorilla Glass Victus+ | sAMOLED Display with Vision Booster

You Might Also Like

Euroclear reports robust H1 2025 results
News

Euroclear reports robust H1 2025 results

19/07/2025
Oregon Institute of Technology Expands Student Coaching Initiative to Boost Retention and Re-Engage Stopped-Out Learners
Business

Oregon Institute of Technology Expands Student Coaching Initiative to Boost Retention and Re-Engage Stopped-Out Learners

04/06/2025
Confluence Launches Style Analytics Fixed Income, Bringing Transparency to a Traditionally Opaque Asset Class
Business

Confluence Launches Style Analytics Fixed Income, Bringing Transparency to a Traditionally Opaque Asset Class

02/07/2025
Rhythm Pharmaceuticals Presents Data on MC4R Agonists Setmelanotide and Bivamelagon at ENDO 2025
Health

Rhythm Pharmaceuticals Presents Data on MC4R Agonists Setmelanotide and Bivamelagon at ENDO 2025

13/07/2025
Life Care News
Facebook Twitter Youtube Rss Medium

Life Care News:


We increase the awareness of millions of users through our news networks. We are one of the most trusted news networks in the world.

Top Categories
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Usefull Links
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Copyright © 2015 – 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Life Care NewsLife Care News
Copyright © 2015 - 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?