Wednesday, 10 Dec 2025
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Subscribe
Life Care News
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
    NewsShow More
    Ryan Group Celebrates 50 Years at the 21st Ryan International Children’s Festival in Mumbai
    Ryan Group Celebrates 50 Years at the 21st Ryan International Children’s Festival in Mumbai
    10/12/2025
    Comarch Named a Strong Performer in Loyalty Platforms Evaluation by Independent Research Firm
    Comarch Named a Strong Performer in Loyalty Platforms Evaluation by Independent Research Firm
    09/12/2025
    Yakima Chief Hops Launches Latest Pink Boots Blend, Strengthening Education and Gender Diversity in Fermentation
    Yakima Chief Hops Launches Latest Pink Boots Blend, Strengthening Education and Gender Diversity in Fermentation
    09/12/2025
    With Child Deaths Projected to Rise for the First Time in a Century, Gates Foundation and Mohamed Bin Zayed Foundation for Humanity Urge Action as World Faces Critical Turning Point
    With Child Deaths Projected to Rise for the First Time in a Century, Gates Foundation and Mohamed Bin Zayed Foundation for Humanity Urge Action as World Faces Critical Turning Point
    09/12/2025
    Bybit Institutional Sets the Stage for 2026 at High-Profile Abu Dhabi Gala
    Bybit Institutional Sets the Stage for 2026 at High-Profile Abu Dhabi Gala
    09/12/2025
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
  • 🔥
  • news
  • global
  •  and
  •  the
  • announced
  • today
  • Business
  • Tech
  •  for
  • will
Font ResizerAa
Life Care NewsLife Care News
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Search
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Follow US
© 2022 Foxiz News Network. Ruby Design Company. All Rights Reserved.
Health

KFSHRC Saves Saudi 7-Year-Old Through Cross-Border Heart Transplant with UAE Donor

GlobeNews Wire
Last updated: 26/08/2025 11:32 PM
GlobeNews Wire
Share
3 Min Read
KFSHRC Saves Saudi 7-Year-Old Through Cross-Border Heart Transplant with UAE Donor
SHARE
KFSHRC Saves Saudi 7-Year-Old Through Cross-Border Heart Transplant with UAE Donor

RIYADH, Saudi Arabia, Aug. 26, 2025 (GLOBE NEWSWIRE) — King Faisal Specialist Hospital and Research Centre (KFSHRC) in Riyadh has successfully performed a life-saving heart transplant on a 7-year-old Saudi child using an organ donated by a brain-dead donor in Abu Dhabi, United Arab Emirates.

The complex procedure was made possible through seamless cross-border cooperation between the Saudi Center for Organ Transplantation and the UAE’s National Program for Donation and Transplantation of Human Organs and Tissue (HAYAT), with full consent from the donor’s family and all regulatory approvals in place.

This cooperation involved precise medical and logistical coordination, starting with the organ extraction, followed by air transportation to Riyadh, and concluding with the preparation of operating theaters in record time. The transplantation was performed within a critically time-sensitive window, ultimately saving the life of a child who had no other treatment options available.

The medical team at KFSHRC performed the transplantation on the child, who was suffering from advanced heart failure due to a complex congenital heart defect. After exhausting all available treatment options—including medications, respiratory support, and pacemaker implantation—without any significant improvement, the child was placed on the urgent transplant list.

Time is a critical factor in heart transplant operations. According to medical standards, the period between removing the heart from the donor and transplanting it into the patient must not exceed five hours to ensure transplant success. This time constraint creates significant logistical challenges in addition to the complex medical procedures, particularly when the brain-dead donor is located in another region within the Kingdom or overseas. In such circumstances, every minute of delay becomes crucial to the operation’s success.

The KFSHRC Heart Centre is recognized as one of the world’s leading cardiac centers, having achieved exceptional milestones including the world’s first fully robotic heart transplant and robotic artificial heart pump implantation without chest incision. These unprecedented medical breakthroughs demonstrate the Kingdom’s leadership in complex cardiac surgery.

KFSHRC has been ranked first in the Middle East and North Africa and 15th globally in the list of the world’s top 250 Academic Medical Centers for the second consecutive year and has been recognized as the most valuable healthcare brand in the Kingdom and the Middle East, according to the 2024 Brand Finance rankings. It was included in the world’s best 250 hospitals and in the World’s Best Smart Hospitals list for 2025 by Newsweek magazine.

For more information, visit www.kfshrc.edu.sa or contact our media team at mediacoverage@kfshrc.edu.sa.

A photo accompanying this announcement is available at:
https://www.globenewswire.com/NewsRoom/AttachmentNg/aaf4d900-7f18-4871-9809-29e19875c14a

Firstsource recognized as a ‘Leader’ for the second consecutive year in Avasant’s Mortgage Business Process Transformation 2025 RadarView
Loka Achieves AWS Agentic AI Specialization
AMPS Achieves HITRUST e1 Certification, Solidifying Commitment to Data Security in Healthcare
Young voices drive SCO innovation and culture
Casio to Release G-SHOCK with Minimalist Metal Design and Even Better Fit
TAGGED: with7-year-oldabuarabiaaugbraindeadcentrechildcooperationcross-borderdhabidonateddonorfaisalglobehearthospitalkfshrckinglifesavingnewsnewswireorganperformedResearchriyadhsaudisavesspecialistsuccessfullythroughtransplanttransplantationuaeunitedusingyearold
Share This Article
Facebook Copy Link Print
- Advertisement -

Your Trusted Source for Accurate and Timely Updates!

Our commitment to accuracy, impartiality, and delivering breaking news as it happens has earned us the trust of a vast audience. Stay ahead with real-time updates on the latest events, trends.
FacebookLike
XFollow
PinterestPin
InstagramFollow
YoutubeSubscribe
LinkedInFollow
MediumFollow

Most Selling Products

Top Picks, Trending Now – Discover the Best Sellers!
Tecno Camon 20 Premier 5G

Tecno Camon 20 Premier 5G

Dark Welkin | 8GB RAM + 512GB Storage (Expandable RAM up to 16GB) | Industry’s 1st 50MP RGBW-Pro Camera | Segment-First 108MP Ultra-Wide Macro Lens | 6.67" 120Hz 10-bit AMOLED In-Display

iQOO Z10 Lite 5G

iQOO Z10 Lite 5G

Titanium Blue | 6GB RAM + 128GB Storage | Dimensity 6300 5G with 433K+ AnTuTu Score | Robust 6000mAh Battery | IP64 Rated + Military-Grade Shock Resistance

OnePlus 13s

OnePlus 13s

Black Velvet | 12GB RAM + 256GB Storage | Flagship Snapdragon® 8 Elite Chipset | Exceptional Battery Life in a Compact Form | Lifetime Display Warranty Included

Samsung Galaxy A55 5G

Samsung Galaxy A55 5G

Awesome Iceblue | 8GB RAM + 256GB Storage | Premium Metal Frame | 50MP OIS Main Camera with Nightography | IP67 Water & Dust Resistance | Gorilla Glass Victus+ | sAMOLED Display with Vision Booster

You Might Also Like

EatProtein Launches New Plant Based (Vegan) Protein Powder Specifically Designed for Womens Wellness
Sports

EatProtein Launches New Plant Based (Vegan) Protein Powder Specifically Designed for Womens Wellness

06/07/2025
Rodic Consultants Announces 'Rodic Advisory & Technology' to Power Data-Driven Governance
Business

Rodic Consultants Announces 'Rodic Advisory & Technology' to Power Data-Driven Governance

26/10/2025
ICHORtec and Johns Hopkins University Expand Collaboration to Enhance CRISPR Gene Editing Specificity Using Quantum FMB Technology
Health

ICHORtec and Johns Hopkins University Expand Collaboration to Enhance CRISPR Gene Editing Specificity Using Quantum FMB Technology

30/10/2025
ICHORtec and Johns Hopkins University Expand Collaboration to Enhance CRISPR Gene Editing Specificity Using Quantum FMB Technology
Automobile

CellPoint Digital Appoints Travel Technology Pioneers Julia Sattel and Kathleen Merrill to Board of Directors

16/09/2025
Life Care News
Facebook Twitter Youtube Rss Medium

Life Care News:


We increase the awareness of millions of users through our news networks. We are one of the most trusted news networks in the world.

Top Categories
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Usefull Links
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Copyright © 2015 – 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Life Care NewsLife Care News
Copyright © 2015 - 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?