Sunday, 1 Feb 2026
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Subscribe
Life Care News
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
    NewsShow More
    World Customs Organization praises ‘e-commerce platform’ in trilingual report
    World Customs Organization praises ‘e-commerce platform’ in trilingual report
    31/12/2025
    Shri Acharya Devvrat, Governor of Gujarat, and Union Ministers Shri Kinjarapu Ram Mohan Naidu & Gajendra Singh Shekhawat Grace Namotsav at Sanskardham
    Shri Acharya Devvrat, Governor of Gujarat, and Union Ministers Shri Kinjarapu Ram Mohan Naidu & Gajendra Singh Shekhawat Grace Namotsav at Sanskardham
    31/12/2025
    International Forum “Problem-Solving City: Hong Kong as a Disputes Resolver”
    International Forum “Problem-Solving City: Hong Kong as a Disputes Resolver”
    28/12/2025
    Roca Group opens the Roca Delhi Gallery, its first in India, as part of its international network of design-led cultural spaces
    Roca Group opens the Roca Delhi Gallery, its first in India, as part of its international network of design-led cultural spaces
    28/12/2025
    Confidence Surges Among Small Enterprises Despite Global Headwinds, Reflecting India’s Strong Economic Momentum – ASSOCHAM Dun & Bradstreet Small Business Confidence Index
    Confidence Surges Among Small Enterprises Despite Global Headwinds, Reflecting India’s Strong Economic Momentum – ASSOCHAM Dun & Bradstreet Small Business Confidence Index
    27/12/2025
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
  • 🔥
  • news
  • global
  •  and
  •  the
  • announced
  • today
  • Business
  • Tech
  •  for
  • will
Font ResizerAa
Life Care NewsLife Care News
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Search
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Follow US
© 2022 Foxiz News Network. Ruby Design Company. All Rights Reserved.
Food

MSI Announces ‘MSI Lucky Friday’ Sale with Exciting Deals on Gaming & Productivity Laptops

PRNW Agency
Last updated: 26/11/2025 12:31 PM
PRNW Agency
Share
5 Min Read
MSI Announces ‘MSI Lucky Friday’ Sale with Exciting Deals on Gaming & Productivity Laptops
SHARE
MSI Announces ‘MSI Lucky Friday’ Sale with Exciting Deals on Gaming & Productivity Laptops

~ MSI’s Black Friday offers live from 23rd to 30th November on Amazon & Flipkart ~
~ Massive discounts up to 40% across gaming and non-gaming models starting INR 33,990/- ~

- Advertisement -

MUMBAI, India, Nov. 26, 2025 /PRNewswire/ — MSI, the innovative computing manufacturer in gaming, creator and business laptops, has announced its ‘MSI Lucky Friday’ Black Friday Sale, bringing exciting offers on some of its most popular laptop series. The week-long sale, live from 23rd to 30th November 2025, will be available on Amazon and Flipkart, offering customers an opportunity to upgrade to premium performance at never-seen-before pricing.

- Advertisement -

The MSI Lucky Friday sale features blockbuster offers across Gaming and Non-Gaming line-ups, with discounts of up to 40% on select models.

- Advertisement -

Speaking on announcement, Mr. James Sung, NB Sales Director, MSI said “Black Friday has become one of the most anticipated shopping moments for Indian consumers and MSI is proud to participate with some of the strongest offers. This year, we are pushing the bar even higher with a sharper focus on our most loved models and wide availability across Amazon and Flipkart. Whether you’re upgrading for studies, content creation, work, or high-octane gaming, this is the best time to experience MSI’s performance ecosystem at its most powerful and most accessible”

- Advertisement -

For more details on the offers: https://msi.gm/SBB2BCFE

- Advertisement -

In addition to the ‘Lucky Friday’ Sale, MSI is also rolling out exclusive offers for purchases made through our official MSI Laptop Brand Stores. Customers can enjoy a complimentary MSI backpack bundle along with a special warranty extension, available only on select models purchased directly from the brand store. These benefits provide added value and make the in-store purchase experience even more rewarding for all customers.

- Advertisement -

For more details on the in store offers: https://in.msi.com/Landing/msi-laptop-brand-store/nb

- Advertisement -

The following options are available with exciting features and offers from which you can pick the one that best suits your needs!

- Advertisement -

MSI Gaming Laptops

- Advertisement -

Model

Specifications

Promotional Price

Katana 15 B13UDXK-2401IN

Intel Core i5 13th Gen 13420H / NVIDIA GeForce RTX 3050 / 16GB DDR5/1TB

INR 74,990/-

Thin 15 B13UC-1805IN / 125IN

Intel Core i5-13420H / NVIDIA GeForce RTX 3050 /16GB DDR4/ 512GB

INR 61,990/-

Thin 15 B13UC-1804IN / 124IN

13th Generation Intel Core i7-13620H /NVIDIA GeForce RTX 3050 /16GB DDR4 /512GB

INR 69,990/-

Thin A15 B7UC-104IN / 488IN

NVIDIA GeForce RTX 3050 /AMD Ryzen 5 7535HS /16GB DDR5/ 1TB

INR 62,990/-

Thin A15 B7UC

NVIDIA GeForce RTX 3050 / AMD Ryzen 5 7535HS / GDDR6 4GB/16GB DDR5/512GB

INR 69,990/59,990/-

Vector A18 HX

NVIDIA GeForce RTX 5070 / AMD Ryzen 9 9955HX /32GB DDR5/ 1TB

INR 2,64,990/-

Katana 15 HX

Intel Core i5 14450HX / NVIDIA GeForce RTX 5050 /16GB DDR5/ 512GB

INR 97,990/-

MSI Business & Productivity Laptops

- Advertisement -

Model

Specifications

Promotional Price

Modern 14 C7M-284IN / 105IN

AMD Radeon/ AMD Ryzen 5 730U / 8GB DDR4 / 512GB

INR 38,990/-

Modern 14 C13M-115IN

Intel Core i3 13th Gen 1315U / UHD Graphics / 8 GB DDR4 / 512GB

INR 33,990/-

Modern 14 C12MO-1400IN

Intel 12th Gen. i5-1235U / Iris Xe Graphics / 4GBx2 DDR4 / 512GB

INR 40,990/-

Prestige 16 AI Studio B1VEG-071IN

Intel Core Ultra 7 155H / NVIDIA GeForce RTX 4050 / 16GBx2 LPDDR5 /1TB

INR 1,39,990/-

Prestige 16 AI Studio B1VFG-070IN

 Intel Core Ultra 7 155H / NVIDIA GeForce RTX 4060 / 

LPDDR5 / 1TB

INR 1,49,990/-

Modern 14 C13M-116IN / 117IN / 119IN

Intel 13th Gen. Core i5 1334U / Iris Xe Graphics / 16GB DDR4 / 512GB

INR 45,990/-

Modern 14 C7M

AMD Radeon / AMD Ryzen 5 7530U/8GBx2 DDR4/512GB

INR 41,990/-

About MSI

- Advertisement -

MSI is a world leader in gaming, content creation and AIoT solutions. Bolstered by its cutting-edge R&D capabilities and customer-driven innovation, MSI has a wide-ranging global presence spanning over 120 countries. Its comprehensive lineup of laptops, graphics cards, monitors, motherboards, desktops, peripherals, servers, IPCs, robotic appliances, and vehicle infotainment and telematics systems are globally acclaimed. Committed to advancing user experiences through the finest product quality, intuitive user interface and design aesthetics, MSI is a leading brand that shapes the future of technology. For more product information, please go to https://www.msi.com.

- Advertisement -

MSI Gaming: https://in.msi.com/
MSI Facebook
: https://www.facebook.com/MSIGamingIndia/
https://www.facebook.com/MSIIndia
MSI Instagram: https://www.instagram.com/msigaming_india/
https://www.instagram.com/msi_india/?hl=en

- Advertisement -

 

- Advertisement -

View original content:https://www.prnewswire.com/in/news-releases/msi-announces-msi-lucky-friday-sale-with-exciting-deals-on-gaming–productivity-laptops-302625891.html

- Advertisement -
SilentSwap V2 Launch Sets New Standard for Institutional Blockchain Privacy Infrastructure
Bybit Partners with Sygnum to Bring Off-Exchange, Swiss-Regulated Custody to Strengthen Institutional Crypto Security
HR Path Strengthens Global Presence with Strategic Acquisition of PredictiveHR
CWAB 2025 Honours Raheja Universal Among India’s Top Builders
Dram Bell Premium Triumphs Consecutive Silver Medals at IWSC and ISC 2025
TAGGED: withacrossamazonannouncedannouncesblackbringingBusinesscomputingcreatordealsdiscountsexcitingflipkartfridaygamingindia:innovativeinrlaptopsliveluckymanufacturermassivemodelsmsimsismumbainewsnongamingnovnovemberoffersproductivitysalestarting
Share This Article
Facebook Copy Link Print
- Advertisement -

Your Trusted Source for Accurate and Timely Updates!

Our commitment to accuracy, impartiality, and delivering breaking news as it happens has earned us the trust of a vast audience. Stay ahead with real-time updates on the latest events, trends.
FacebookLike
XFollow
PinterestPin
InstagramFollow
YoutubeSubscribe
LinkedInFollow
MediumFollow

Most Selling Products

Top Picks, Trending Now – Discover the Best Sellers!
Tecno Camon 20 Premier 5G

Tecno Camon 20 Premier 5G

Dark Welkin | 8GB RAM + 512GB Storage (Expandable RAM up to 16GB) | Industry’s 1st 50MP RGBW-Pro Camera | Segment-First 108MP Ultra-Wide Macro Lens | 6.67" 120Hz 10-bit AMOLED In-Display

iQOO Z10 Lite 5G

iQOO Z10 Lite 5G

Titanium Blue | 6GB RAM + 128GB Storage | Dimensity 6300 5G with 433K+ AnTuTu Score | Robust 6000mAh Battery | IP64 Rated + Military-Grade Shock Resistance

OnePlus 13s

OnePlus 13s

Black Velvet | 12GB RAM + 256GB Storage | Flagship Snapdragon® 8 Elite Chipset | Exceptional Battery Life in a Compact Form | Lifetime Display Warranty Included

Samsung Galaxy A55 5G

Samsung Galaxy A55 5G

Awesome Iceblue | 8GB RAM + 256GB Storage | Premium Metal Frame | 50MP OIS Main Camera with Nightography | IP67 Water & Dust Resistance | Gorilla Glass Victus+ | sAMOLED Display with Vision Booster

You Might Also Like

New Survey Finds Employers Keen on Hiring Business School Graduates as AI Integration Accelerates
News

New Survey Finds Employers Keen on Hiring Business School Graduates as AI Integration Accelerates

02/07/2025
Gates Foundation Announces Catalytic Funding to Spark New Era of Women-Centered Research and Innovation
News

Gates Foundation Announces Catalytic Funding to Spark New Era of Women-Centered Research and Innovation

04/08/2025
KLEVV LAUNCHES ENHANCED SSD LINEUP: CRAS C925G, CRAS C910G NVME SSDS, AND NEO N410+ SATA SSD
Food

KLEVV LAUNCHES ENHANCED SSD LINEUP: CRAS C925G, CRAS C910G NVME SSDS, AND NEO N410+ SATA SSD

24/07/2025
G-P Joins Built on Workday Program
Tech

G-P Joins Built on Workday Program

28/08/2025
Life Care News
Facebook Twitter Youtube Rss Medium

Life Care News:


We increase the awareness of millions of users through our news networks. We are one of the most trusted news networks in the world.

Top Categories
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Usefull Links
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Copyright © 2015 – 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Life Care NewsLife Care News
Copyright © 2015 - 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?