Monday, 22 Sep 2025
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Subscribe
Life Care News
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
    NewsShow More
    Birla Carbon Releases 2025 Sustainability Report ‘Connected to a Greener Future’
    Birla Carbon Releases 2025 Sustainability Report ‘Connected to a Greener Future’
    22/09/2025
    All-Scenario Grid Forming Technology, Accelerating Wind and Solar as Main Power
    All-Scenario Grid Forming Technology, Accelerating Wind and Solar as Main Power
    22/09/2025
    Huawei and Industry Pioneers Unveil Over 30 Global Benchmark Showcases for Digital and Intelligent Transformation in the Data Communication Domain
    Huawei and Industry Pioneers Unveil Over 30 Global Benchmark Showcases for Digital and Intelligent Transformation in the Data Communication Domain
    21/09/2025
    India’s EV Charging Leaders Unite: ‘Indian Charge Point Operators Association’ (ICPOA) to Power the Next Wave of Electric Mobility
    India’s EV Charging Leaders Unite: ‘Indian Charge Point Operators Association’ (ICPOA) to Power the Next Wave of Electric Mobility
    21/09/2025
    Woxsen University Secures Top 5 Position in India in QS Business Masters Rankings 2025-26
    Woxsen University Secures Top 5 Position in India in QS Business Masters Rankings 2025-26
    20/09/2025
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
  • 🔥
  • news
  • global
  • june
  • Business
  • july
  • announced
  • today
  •  and
  •  the
  • Tech
Font ResizerAa
Life Care NewsLife Care News
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Search
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Follow US
© 2022 Foxiz News Network. Ruby Design Company. All Rights Reserved.
Health

Revive Therapeutics Clarifies Completion of Key Nerve Agent Countermeasure Study

GlobeNews Wire
Last updated: 09/07/2025 8:22 AM
GlobeNews Wire
Share
4 Min Read
Revive Therapeutics Clarifies Completion of Key Nerve Agent Countermeasure Study
SHARE
Revive Therapeutics Clarifies Completion of Key Nerve Agent Countermeasure Study

TORONTO, July 08, 2025 (GLOBE NEWSWIRE) — Revive Therapeutics Ltd. (“Revive” or the “Company”) (OTCQB: RVVTF) (CSE: RVV) (FRANKFURT:31R), a specialized life sciences company dedicated to the research and development of therapeutics for infectious diseases and medical countermeasures, hereby clarifies its update regarding the research study assessing Bucillamine as a potential treatment for nerve agent exposure. This study is being conducted in collaboration with Defence R&D Canada – Suffield Research Centre (“DRDC”), an agency of the Canadian Department of National Defence, which is investigating pharmacological compounds, including Bucillamine, capable of mitigating nerve agent-induced brain injury.

The research study with Bucillamine is slated for continuation through September 2025, and its findings will be disseminated exclusively with the express authorization of the DRDC. The Company affirms that future research endeavours with DRDC have not been broached and would only be deliberated subsequent to the conclusion of the current research study and contingent upon the satisfactory nature of its results, warranting further investigation.

About Revive Therapeutics Ltd.

Revive Therapeutics is a life sciences company focused on the research and development of therapeutics for infectious diseases and medical countermeasures. Revive prioritizes its drug development efforts to take advantage of several regulatory incentives awarded by the FDA, such as Emergency Use Authorization, Orphan Drug, Fast Track, and Breakthrough Therapy designations. Currently, the Company is exploring the use of Bucillamine for the potential treatment of nerve agent exposure and long COVID. Revive is also advancing the development of Psilocybin and molecular hydrogen therapeutics through various programs. For more information, visit www.ReviveThera.com.

For more information, please contact:

Michael Frank
Chief Executive Officer
Revive Therapeutics Ltd.
Tel: 1 888 901 0036
Email: mfrank@revivethera.com
Website: www.revivethera.com

Neither the Canadian Securities Exchange nor its Regulation Services Provider has reviewed or accepts responsibility for the adequacy or accuracy of this release.

Cautionary Statement

This press release contains ‘forward-looking information’ within the meaning of applicable Canadian securities legislation. These statements relate to future events or future performance. The use of any of the words “may”, “could”, “intend”, “expect”, “believe”, “will”, “projected”, “estimated” and similar expressions and statements relating to matters that are not historical facts are intended to identify forward-looking information and are based on Revive’s current belief or assumptions as to the outcome and timing of such future events. Forward looking information in this press release includes information with respect to the Company’s cannabinoids, psychedelics and infectious diseases programs. Forward-looking information is based on reasonable assumptions that have been made by Revive at the date of the information and is subject to known and unknown risks, uncertainties, and other factors that may cause actual results or events to differ materially from those anticipated in the forward-looking information. Given these risks, uncertainties and assumptions, you should not unduly rely on these forward-looking statements. The forward-looking information contained in this press release is made as of the date hereof, and Revive is not obligated to update or revise any forward-looking information, whether as a result of new information, future events or otherwise, except as required by applicable securities laws. The foregoing statements expressly qualify any forward-looking information contained herein. Reference is made to the risk factors disclosed under the heading “Risk Factors” in the Company’s management’s discussion and analysis for the three and nine months ended March 31, 2025 (“MD&A”), dated May 29, 2025, which is available on the Company’s profile at www.sedarplus.ca.

Crypto Funds Watch Acquires CryptoFund.News
Nomad Internet Launches First-Ever Nationwide Free Internet Service for RV Parks
Africa Wealth Report 2025: Continent Outpaces Global Growth as New Wealth Hubs Surge
Portage Biotech Reports Results for Fiscal Year Ended March 31, 2025
WhiteHawk Completes Tender Offer for Acquisition of PHX
TAGGED:agentbucillamineCA7615161030clarifiesCNSX:RVVCNSX:RVV.CNcompanycompletioncountermeasurecountermeasurescsededicateddefencedevelopmentdiseasesdrdcFrankfurt:31RfrankfurtrglobeherebyinfectiousjulykeylifeltdmedicalnervenewsnewswireotcqbOther OTC:RVVTFResearchrevivervvrvvtfsciencesspecializedstudytherapeuticstoronto
Share This Article
Facebook Copy Link Print
- Advertisement -

Your Trusted Source for Accurate and Timely Updates!

Our commitment to accuracy, impartiality, and delivering breaking news as it happens has earned us the trust of a vast audience. Stay ahead with real-time updates on the latest events, trends.
FacebookLike
XFollow
PinterestPin
InstagramFollow
YoutubeSubscribe
LinkedInFollow
MediumFollow

Most Selling Products

Top Picks, Trending Now – Discover the Best Sellers!
Tecno Camon 20 Premier 5G

Tecno Camon 20 Premier 5G

Dark Welkin | 8GB RAM + 512GB Storage (Expandable RAM up to 16GB) | Industry’s 1st 50MP RGBW-Pro Camera | Segment-First 108MP Ultra-Wide Macro Lens | 6.67" 120Hz 10-bit AMOLED In-Display

iQOO Z10 Lite 5G

iQOO Z10 Lite 5G

Titanium Blue | 6GB RAM + 128GB Storage | Dimensity 6300 5G with 433K+ AnTuTu Score | Robust 6000mAh Battery | IP64 Rated + Military-Grade Shock Resistance

OnePlus 13s

OnePlus 13s

Black Velvet | 12GB RAM + 256GB Storage | Flagship Snapdragon® 8 Elite Chipset | Exceptional Battery Life in a Compact Form | Lifetime Display Warranty Included

Samsung Galaxy A55 5G

Samsung Galaxy A55 5G

Awesome Iceblue | 8GB RAM + 256GB Storage | Premium Metal Frame | 50MP OIS Main Camera with Nightography | IP67 Water & Dust Resistance | Gorilla Glass Victus+ | sAMOLED Display with Vision Booster

You Might Also Like

Parimatch Sports Presents: Inside the Game with Sachin Baby & Taniyaa Bhatia
Sports

Parimatch Sports Presents: Inside the Game with Sachin Baby & Taniyaa Bhatia

04/07/2025
Global Excel Acquires First Assistance to Strengthen Assistance Services and Expand in the Asia-Pacific Market
Health

Global Excel Acquires First Assistance to Strengthen Assistance Services and Expand in the Asia-Pacific Market

03/07/2025

NEXEN TIRE Expands OE Supply for KIAs Global Strategic Models

22/07/2025
Huawei Named a 2025 Gartner Peer InsightsTM Customers’ Choice for File and Object Storage Platforms for the Fourth Year Running
Entertainment

Huawei Named a 2025 Gartner Peer InsightsTM Customers’ Choice for File and Object Storage Platforms for the Fourth Year Running

10/07/2025
Life Care News
Facebook Twitter Youtube Rss Medium

Life Care News:


We increase the awareness of millions of users through our news networks. We are one of the most trusted news networks in the world.

Top Categories
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Usefull Links
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Copyright © 2015 – 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Life Care NewsLife Care News
Copyright © 2015 - 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?