Friday, 9 Jan 2026
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Subscribe
Life Care News
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
    NewsShow More
    World Customs Organization praises ‘e-commerce platform’ in trilingual report
    World Customs Organization praises ‘e-commerce platform’ in trilingual report
    31/12/2025
    Shri Acharya Devvrat, Governor of Gujarat, and Union Ministers Shri Kinjarapu Ram Mohan Naidu & Gajendra Singh Shekhawat Grace Namotsav at Sanskardham
    Shri Acharya Devvrat, Governor of Gujarat, and Union Ministers Shri Kinjarapu Ram Mohan Naidu & Gajendra Singh Shekhawat Grace Namotsav at Sanskardham
    31/12/2025
    International Forum “Problem-Solving City: Hong Kong as a Disputes Resolver”
    International Forum “Problem-Solving City: Hong Kong as a Disputes Resolver”
    28/12/2025
    Roca Group opens the Roca Delhi Gallery, its first in India, as part of its international network of design-led cultural spaces
    Roca Group opens the Roca Delhi Gallery, its first in India, as part of its international network of design-led cultural spaces
    28/12/2025
    Confidence Surges Among Small Enterprises Despite Global Headwinds, Reflecting India’s Strong Economic Momentum – ASSOCHAM Dun & Bradstreet Small Business Confidence Index
    Confidence Surges Among Small Enterprises Despite Global Headwinds, Reflecting India’s Strong Economic Momentum – ASSOCHAM Dun & Bradstreet Small Business Confidence Index
    27/12/2025
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
  • 🔥
  • news
  • global
  •  and
  •  the
  • announced
  • today
  • Business
  • Tech
  •  for
  • will
Font ResizerAa
Life Care NewsLife Care News
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Search
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Follow US
© 2022 Foxiz News Network. Ruby Design Company. All Rights Reserved.
Tech

Swift Navigation and Taiwan Mobile Partner to Unlock Autonomy and Automation with Centimeter-Accurate Positioning

GlobeNews Wire
Last updated: 12/08/2025 5:32 AM
GlobeNews Wire
Share
5 Min Read
Swift Navigation and Taiwan Mobile Partner to Unlock Autonomy and Automation with Centimeter-Accurate Positioning
SHARE
Swift Navigation and Taiwan Mobile Partner to Unlock Autonomy and Automation with Centimeter-Accurate Positioning

SAN FRANCISCO and TAIPEI, Taiwan, Aug. 11, 2025 (GLOBE NEWSWIRE) — Swift Navigation, the leader in centimeter-accurate positioning for vehicle autonomy, robotics, and precision logistics, and Taiwan Mobile, one of Taiwan’s leading telecommunications companies, today announced their partnership to bring SkylarkTM Precise Positioning Service to the Taiwanese market. This collaboration addresses the growing demand for high-accuracy positioning across industries.

Skylark is a real-time GNSS correction service that delivers centimeter-level accuracy by correcting errors in signals from Global Navigation Satellite Systems (GNSS), such as GPS. It is the first and only cloud-based precise positioning service purpose-built to unlock mass market applications. Skylark is uniquely architected to ensure accuracy, reliability, and safety at global scale. Leveraging Swift’s advanced atmospheric modeling, Skylark mitigates errors caused by ionospheric disturbances, clock drift, and orbital inaccuracies—improving positioning precision from several meters to just a few centimeters.

Deployed on a carrier-grade network of state-of-the-art ground reference stations—designed and operated in partnership with Taiwan Mobile and other MNOs around the world—Skylark delivers highly reliable, precise positioning to the Taiwanese market, powering next-generation applications, including:

  • Automotive: The first and only ASIL-certified, real-time cloud-based positioning service (ISO 26262:2018), Skylark enables safe and precise operation of ADAS-enabled and autonomous vehicles everywhere—always.
  • Robotics: Swift’s proprietary atmospheric modeling delivers centimeter-level accuracy with extended baselines and automatic failover, ensuring that robotic lawnmowers and surveying drones work as intended right out of the box.
  • Fleet Management: Skylark offers a cost-effective reliable positioning solution to optimize the last mile and final inch. Skylark is optimized for battery-powered devices and integrates seamlessly with a wide range of compatible GNSS components.

“The expansion made possible through our partnership with Taiwan Mobile marks an exciting milestone in our mission to bring high-integrity, precise positioning to the world,” said Holger Ippach, Executive Vice President of Product & Marketing at Swift Navigation. “Taiwan is a leader in technology and innovation, making it a perfect market for Skylark’s cloud-based correction service, helping shape the future of mobility and automation in Asia and beyond.”

For more information about Taiwan Mobile’s Precise Positioning offering, visit: https://www.twmsolution.com/iot/Precise_Positioning/ (in Traditional Chinese)

Skylark is also available across North America, Europe, and Asia. For more information about Skylark, visit: https://www.swiftnav.com/products/skylark

ABOUT SWIFT NAVIGATION
Swift Navigation is a San Francisco-based technology company transforming precise positioning across industries. Its SkylarkTM Precise Positioning Service delivers real-time, centimeter-accurate positioning at scale, enabling applications in autonomous driving, robotics, precision logistics, and V2X communication. Trusted by leading automotive OEMs, Tier 1 suppliers, robotics companies, IoT system integrators, and mobile handset OEMs, Skylark powers more than 10 million ADAS-enabled and autonomous vehicles and devices worldwide. Learn how Swift is building the infrastructure for a safer, more connected future at swiftnav.com.

ABOUT TAIWAN MOBILE
Taiwan Mobile, established in 1997, is a leading telecommunications provider in Taiwan.Taiwan Mobile leverages “Telco+Tech” strategy to integrate telecom, network, media, entertainment, and e-commerce group synergy, creating a “convergence-into-one” platform that provides technology solutions—including AI, IoT, Cloud, Cybersecurity, TelcoFin, Web3, EV charging stations, Game, and more. Under the 5G+ strategy, Taiwan Mobile uses big data and its user base (Gift) to create synergies with momo and AppWorks (Group), while focusing on sustainability (Green) and long-term growth (Grit) to expand in Greater South East Asia (GESA). Embracing the “Open Possible” spirit, Taiwan Mobile delivers diverse tech solutions, enabling users to transcend limits and unlock endless new experiences. For more information, please visit: https://english.taiwanmobile.com/

A photo accompanying this announcement is available at https://www.globenewswire.com/NewsRoom/AttachmentNg/ec392267-eb5a-4b9c-8198-f8df915847aa

 

Funds Advised by Convergent Finance to Acquire 10.3% Stake in Knowledge Marine & Engineering Works Limited for USD 27.4 Million
Foxtale Evolves Into a House of Brands; Introduces Hula Hoop by Foxtale, Following 700-Crore Topline GMV Milestone
World Peace Concert SOUND OF PEACE: International Benefit Concert for Peace to Take Place for the First Time in Front of the Iconic St. Peter’s Square
Spider Labs Rebrands as Marketing Security Platform to Strengthen Digital Risk Protection
Asuncin Paraguay; Bangkok, Thailand; and Santiago, Chile invited into a Targeted Dialogue for the Youth Olympic Games in 2030
TAGGED: and withaccuracyapplicationsaugautomationautonomycentimeter-accuratecentimeteraccuratedeliverserrorsfranciscoglobalglobegnssleaderlogisticsmarketmobilenavigationnewsnewswirepartnerpartnershippositioningpreciseprecisionroboticssanserviceskylarkswifttaipeitaiwantaiwaneseunlockvehicle
Share This Article
Facebook Copy Link Print
- Advertisement -

Your Trusted Source for Accurate and Timely Updates!

Our commitment to accuracy, impartiality, and delivering breaking news as it happens has earned us the trust of a vast audience. Stay ahead with real-time updates on the latest events, trends.
FacebookLike
XFollow
PinterestPin
InstagramFollow
YoutubeSubscribe
LinkedInFollow
MediumFollow

Most Selling Products

Top Picks, Trending Now – Discover the Best Sellers!
Tecno Camon 20 Premier 5G

Tecno Camon 20 Premier 5G

Dark Welkin | 8GB RAM + 512GB Storage (Expandable RAM up to 16GB) | Industry’s 1st 50MP RGBW-Pro Camera | Segment-First 108MP Ultra-Wide Macro Lens | 6.67" 120Hz 10-bit AMOLED In-Display

iQOO Z10 Lite 5G

iQOO Z10 Lite 5G

Titanium Blue | 6GB RAM + 128GB Storage | Dimensity 6300 5G with 433K+ AnTuTu Score | Robust 6000mAh Battery | IP64 Rated + Military-Grade Shock Resistance

OnePlus 13s

OnePlus 13s

Black Velvet | 12GB RAM + 256GB Storage | Flagship Snapdragon® 8 Elite Chipset | Exceptional Battery Life in a Compact Form | Lifetime Display Warranty Included

Samsung Galaxy A55 5G

Samsung Galaxy A55 5G

Awesome Iceblue | 8GB RAM + 256GB Storage | Premium Metal Frame | 50MP OIS Main Camera with Nightography | IP67 Water & Dust Resistance | Gorilla Glass Victus+ | sAMOLED Display with Vision Booster

You Might Also Like

Cureus Updates Terms & Conditions to Prohibit AI Use
Entertainment

Cureus Updates Terms & Conditions to Prohibit AI Use

06/09/2025
Cureus Updates Terms & Conditions to Prohibit AI Use
News

Gates Foundation Announces Catalytic Funding to Spark New Era of Women-Centered Research and Innovation

04/08/2025
MobiKwik pioneers Instant Forex purchase in partnership with NBBL
Entertainment

MobiKwik pioneers Instant Forex purchase in partnership with NBBL

18/11/2025

GENESIS EMBARKS ON A NEW DECADE WITH LUXURY HIGH PERFORMANCE

21/11/2025
Life Care News
Facebook Twitter Youtube Rss Medium

Life Care News:


We increase the awareness of millions of users through our news networks. We are one of the most trusted news networks in the world.

Top Categories
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Usefull Links
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Copyright © 2015 – 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Life Care NewsLife Care News
Copyright © 2015 - 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?