Sunday, 21 Sep 2025
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Subscribe
Life Care News
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
    NewsShow More
    Huawei and Industry Pioneers Unveil Over 30 Global Benchmark Showcases for Digital and Intelligent Transformation in the Data Communication Domain
    Huawei and Industry Pioneers Unveil Over 30 Global Benchmark Showcases for Digital and Intelligent Transformation in the Data Communication Domain
    21/09/2025
    India’s EV Charging Leaders Unite: ‘Indian Charge Point Operators Association’ (ICPOA) to Power the Next Wave of Electric Mobility
    India’s EV Charging Leaders Unite: ‘Indian Charge Point Operators Association’ (ICPOA) to Power the Next Wave of Electric Mobility
    21/09/2025
    Woxsen University Secures Top 5 Position in India in QS Business Masters Rankings 2025-26
    Woxsen University Secures Top 5 Position in India in QS Business Masters Rankings 2025-26
    20/09/2025
    Huawei Cloud: Empowering Customers to Succeed in Global Markets Through Continuous Innovation
    Huawei Cloud: Empowering Customers to Succeed in Global Markets Through Continuous Innovation
    20/09/2025
    Grvt Raises M to Pioneer Privacy-First Onchain Finance and Unlock Trillion-Dollar Markets
    Grvt Raises $19M to Pioneer Privacy-First Onchain Finance and Unlock Trillion-Dollar Markets
    19/09/2025
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
  • 🔥
  • news
  • global
  • june
  • Business
  • july
  • announced
  • today
  •  and
  •  the
  • Tech
Font ResizerAa
Life Care NewsLife Care News
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Search
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Follow US
© 2022 Foxiz News Network. Ruby Design Company. All Rights Reserved.
Business

WhistlePig Whiskey Welcomes New CEO Charles Gibb

Business Wire
Last updated: 11/06/2025 7:54 PM
Business Wire
Share
4 Min Read
WhistlePig Whiskey Welcomes New CEO Charles Gibb
SHARE
WhistlePig Whiskey Welcomes New CEO Charles Gibb

Gibb brings global luxury brand building expertise and growth-oriented leadership to the trailblazing craft whiskey producer

- Advertisement -

SHOREHAM, Vt.–(BUSINESS WIRE)–WhistlePig Whiskey, the #1 leader in independent craft whiskey, today welcomes Charles Gibb, a dynamic leader in the spirits industry, as its new Chief Executive Officer. This appointment marks the next stage of evolution for the WhistlePig brand and its highly awarded super premium whiskey portfolio.

- Advertisement -




Charles brings a wide breadth of global expertise to WhistlePig, particularly through the introduction of spirits and cocktail mixers to new audiences across various geographies. He launched Fever-Tree’s North American arm, driving the mixer brand to the top of the ginger beer and tonic water charts while expanding their business to tackle multiple drinking occasions. Previously at Belvedere Vodka, Gibb spearheaded their global expansion efforts – establishing their Project RED and James Bond partnerships, and elevating the brand’s presence worldwide. His tenure at Bacardi, Diageo and Moët Hennessy further underscores a career defined by strategic brand-building, innovation, and international market development.

- Advertisement -

“As a Scot, I could not be more excited to be joining this exceptional American whiskey brand. I thrive in an innovative, dynamic and entrepreneurial environment,” said Gibb. “I’ve been involved with start-ups, initiated new markets and transformed developed markets by breaking apart paradigms to accelerate growth. That’s exactly what WhistlePig does with whiskey. We have the perfect mix to shake up the market. Or stir up, if you prefer.”

- Advertisement -

WhistlePig has never been limited by the way things are done. From transforming an abandoned Vermont dairy barn into a pioneering grain-to-glass distillery to crafting category-defining releases, the brand has taken American whiskey to a new level of quality and innovation. Over the past two years, WhistlePig broke new ground by expanding beyond its signature Ryes into aged Bourbon and super-aged Single Malt. Today, WhistlePig is the market leader in ultra-premium Rye and fastest-growing ultra-premium Bourbon in the US. Gibb joins the team at an inflection point: building on WhistlePig’s market disruption, driving brand growth, and championing bold innovation to offer consumers the world’s best whiskey.

“Post an extensive search process, where we had an opportunity to consider various exceptional candidates, we are excited to welcome Charles to the WhistlePig team as we tackle the next phases of growth,” said Wilco Faessen, Co-Founder and Chairman of WhistlePig Whiskey. “We also want to express our gratitude to Marty Birkel for taking the reins as CEO on an interim basis to enable a thorough search, and the upcoming transition.”

- Advertisement -

To learn more about WhistlePig Whiskey, visit whistlepigwhiskey.com. You can also check out WhistlePig Whiskey on Facebook, X and Instagram.

- Advertisement -

About WhistlePig Whiskey

​​Located off the grid on a 500-acre Vermont farm, WhistlePig Whiskey is crafted by a new generation of whiskey makers driven to reinvent and unlock the flavor of whiskey, starting with Rye. Through rebellious pursuit of experimenting and breaking boundaries in the industry, WhistlePig has become the leading independent craft whiskey brand, awarded Best Rye Whiskey (SFWSC 2021). WhistlePig is committed to becoming the best whiskey both on and for the planet, starting with its solar-powered Farm and distillery, and local grain-to-glass operation. For more information, head to whistlepigwhiskey.com.

- Advertisement -

Contacts

- Advertisement -

whistlepig@dittoepr.com

Foldax Announces Launch of TRIA Mitral Valve in India
Applied Intuition and Komatsu Strike Deal to Transform Mining Industry with Intelligent, Autonomous Machines
Albertsons Companies Appoints Sunil Gopinath as CEO of Albertsons Companies India
ZAlloy: The Future of Cleveland Golf Wedges
Arovia Returns to Kickstarter with the Splay Max The Ultimate Portable 2-in-1 Display and Projector
TAGGED:appointmentbrandbringsbuildingcharleschiefcraftdynamicexecutiveexpertisegibbglobalgrowthorientedindependentindustryleaderleadershipluxurymarksofficerproducershorehamspiritstodaytrailblazingvtbusinesswelcomeswhiskeywhistlepigwirewhistlepig
Share This Article
Facebook Copy Link Print
- Advertisement -

Your Trusted Source for Accurate and Timely Updates!

Our commitment to accuracy, impartiality, and delivering breaking news as it happens has earned us the trust of a vast audience. Stay ahead with real-time updates on the latest events, trends.
FacebookLike
XFollow
PinterestPin
InstagramFollow
YoutubeSubscribe
LinkedInFollow
MediumFollow

Most Selling Products

Top Picks, Trending Now – Discover the Best Sellers!
Tecno Camon 20 Premier 5G

Tecno Camon 20 Premier 5G

Dark Welkin | 8GB RAM + 512GB Storage (Expandable RAM up to 16GB) | Industry’s 1st 50MP RGBW-Pro Camera | Segment-First 108MP Ultra-Wide Macro Lens | 6.67" 120Hz 10-bit AMOLED In-Display

iQOO Z10 Lite 5G

iQOO Z10 Lite 5G

Titanium Blue | 6GB RAM + 128GB Storage | Dimensity 6300 5G with 433K+ AnTuTu Score | Robust 6000mAh Battery | IP64 Rated + Military-Grade Shock Resistance

OnePlus 13s

OnePlus 13s

Black Velvet | 12GB RAM + 256GB Storage | Flagship Snapdragon® 8 Elite Chipset | Exceptional Battery Life in a Compact Form | Lifetime Display Warranty Included

Samsung Galaxy A55 5G

Samsung Galaxy A55 5G

Awesome Iceblue | 8GB RAM + 256GB Storage | Premium Metal Frame | 50MP OIS Main Camera with Nightography | IP67 Water & Dust Resistance | Gorilla Glass Victus+ | sAMOLED Display with Vision Booster

You Might Also Like

Apexon Unveils AgentRise, a Next-Gen Agentic AI Platform for Intelligent Enterprises
Business

Apexon Unveils AgentRise, a Next-Gen Agentic AI Platform for Intelligent Enterprises

03/08/2025
Elliott Statement on The Kansai Electric Power Company, Inc.
Business

Elliott Statement on The Kansai Electric Power Company, Inc.

14/09/2025
Constant Evolution for the Intelligent AIoT Future: Dahua Technology Unveils Xinghan Large-scale AI Models
Business

Constant Evolution for the Intelligent AIoT Future: Dahua Technology Unveils Xinghan Large-scale AI Models

21/09/2025
LINE Investors Have Opportunity to Lead Lineage, Inc. Securities Fraud Lawsuit with the Schall Law Firm
Business

LINE Investors Have Opportunity to Lead Lineage, Inc. Securities Fraud Lawsuit with the Schall Law Firm

04/08/2025
Life Care News
Facebook Twitter Youtube Rss Medium

Life Care News:


We increase the awareness of millions of users through our news networks. We are one of the most trusted news networks in the world.

Top Categories
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Usefull Links
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Copyright © 2015 – 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Life Care NewsLife Care News
Copyright © 2015 - 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?