Thursday, 26 Feb 2026
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Subscribe
Life Care News
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
    NewsShow More
    World Customs Organization praises ‘e-commerce platform’ in trilingual report
    World Customs Organization praises ‘e-commerce platform’ in trilingual report
    31/12/2025
    Shri Acharya Devvrat, Governor of Gujarat, and Union Ministers Shri Kinjarapu Ram Mohan Naidu & Gajendra Singh Shekhawat Grace Namotsav at Sanskardham
    Shri Acharya Devvrat, Governor of Gujarat, and Union Ministers Shri Kinjarapu Ram Mohan Naidu & Gajendra Singh Shekhawat Grace Namotsav at Sanskardham
    31/12/2025
    International Forum “Problem-Solving City: Hong Kong as a Disputes Resolver”
    International Forum “Problem-Solving City: Hong Kong as a Disputes Resolver”
    28/12/2025
    Roca Group opens the Roca Delhi Gallery, its first in India, as part of its international network of design-led cultural spaces
    Roca Group opens the Roca Delhi Gallery, its first in India, as part of its international network of design-led cultural spaces
    28/12/2025
    Confidence Surges Among Small Enterprises Despite Global Headwinds, Reflecting India’s Strong Economic Momentum – ASSOCHAM Dun & Bradstreet Small Business Confidence Index
    Confidence Surges Among Small Enterprises Despite Global Headwinds, Reflecting India’s Strong Economic Momentum – ASSOCHAM Dun & Bradstreet Small Business Confidence Index
    27/12/2025
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
  • 🔥
  • news
  • global
  •  and
  •  the
  • announced
  • today
  • Business
  • Tech
  •  for
  • will
Font ResizerAa
Life Care NewsLife Care News
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Search
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Follow US
© 2022 Foxiz News Network. Ruby Design Company. All Rights Reserved.
Tech

Hollyland Unveils The 5.5-inch All-in-One Wireless Monitor Pyro 5

PRNW Agency
Last updated: 23/08/2025 3:33 PM
PRNW Agency
Share
4 Min Read
Hollyland Unveils The 5.5-inch All-in-One Wireless Monitor Pyro 5
SHARE
Hollyland Unveils The 5.5-inch All-in-One Wireless Monitor Pyro 5

More Than A Screen: Hollyland Unveils The 5.5-inch All-in-One Wireless Monitor Pyro 5 to Boost Efficiency in Professional Film Production

- Advertisement -

SHENZHEN, China, Aug. 21, 2025 /PRNewswire/ — Hollyland proudly announces the launch of the Pyro 5, the latest groundbreaking addition to its Pyro Series lineup. This multifunctional device combines high-definition display, camera control, content management, and real-time transmission capabilities, making it the perfect solution for multi-user monitoring in dynamic shooting scenarios, such as film production, live events, ENG/EFP applications, and more.

- Advertisement -

Powerful, User-Friendly Features that Set Industry Standards

- Advertisement -

The Pyro 5 stands out with its powerful features and user-friendly design, setting a new industry standard. With advanced recording capabilities, including proxy recording and content tagging, post-production processes become significantly more efficient. The built-in image analysis tools, including waveform, focus assist, 3D LUTs, and zebra pattern, allow users to quickly assess image quality, enhancing overall production workflow. The Pyro 5 also features a “Ready Out of the Box” plug-and-play design that simplifies the setup process. Various power options and a quick-release antenna design ensure reliable operation in diverse environments, making transitions on set smoother and more efficient.

- Advertisement -

More than a Screen: Innovative Technology Upgrades

- Advertisement -

In addition to its robust operational capabilities, the Pyro 5 is equipped with a 5.5-inch, 1500-nit high-brightness screen, ensuring that users can easily adjust essential parameters even in challenging outdoor lighting conditions. Supporting 2.4G and 5G dual-band operation, Pyro 5 enhances signal stability and response speed, making it an ideal companion for any production setup. With HDMI and SDI loop-out options, this monitor integrates seamlessly into a variety of production environments as well.

- Advertisement -

Advantages of the Pyro Ecosystem: Enhancing Collaborative Production

- Advertisement -

Building on the strengths of the Pyro series, the Pyro 5 offers a range of ecosystem advantages that facilitate collaborative production. One of the standout features of the Pyro ecosystem is its ability to transmit one signal to four receivers using WiFi broadcast technology, enabling all crew members to monitor in real-time with stable signals. Hollyland’s proprietary Auto Frequency Hopping technology constantly scans and adjusts to find the optimal wireless channel, ensuring reliable connections over distances of up to 400 meters. This capability, combined with low latency and automatic channel optimization, guarantees real-time monitoring without delays. Additionally, the Pyro 5 supports Multi-Cam Switching, allowing seamless transitions between camera groups—an essential capability for keeping up with fast-paced live productions. When multiple Pyro systems are in use, the Lock Pairing feature ensures that each receiver remains securely connected to its original transmitter, preventing any signal mix-ups.

- Advertisement -

The Pyro 5 is now available for purchase through local distributors and Hollyland Amazon store.

- Advertisement -

For more about the pricing and detailed product information, please visit here.

- Advertisement -

Looking ahead, Hollyland plans to continue expanding its product line to develop integrated solutions that meet the growing demands of the market, driving rapid and sustainable industry growth.

- Advertisement -

ABOUT HOLLYLAND TECHNOLOGY

- Advertisement -

Shenzhen Hollyland Technology Co., Ltd. (‘Hollyland’ or ‘Hollyland Technology’) empowers global customers with professional solutions that are expressly designed for wireless data, audio, and video transmission and wireless intercom solutions since 2013. Key products include Solidcom C1, Mars 400s Pro, Mars 4K, Mars M1, Cosmo C1, and Lark M1.

- Advertisement -

Hollyland serves many markets, including filmmaking, television shooting, video production, broadcast, live streaming, live events, exhibitions, broadcast media, production, general events, theatres, houses of worship, rental houses, and more.

- Advertisement -

For more information, visit https://www.hollyland.com/, Hollyland Instagram, Hollyland Facebook, and Hollyland YouTube.

- Advertisement -

Logo – https://mma.prnewswire.com/media/2013148/logo.jpg

- Advertisement -

View original content:https://www.prnewswire.co.uk/news-releases/hollyland-unveils-the-5-5-inch-all-in-one-wireless-monitor-pyro-5–302519502.html

- Advertisement -
Bybit Launches Bybit.eu, a Fully MiCAR-Compliant Platform for Europe’s Crypto Users
Phoenix to Host SEMICON West 2025 for the First Time, Showcasing Arizona’s Critical Role as a Semiconductor Manufacturing Hub
DHL boosts operational efficiency and customer communications with HappyRobots AI Agents
Perfios Partners with SatSure to Revolutionize the Agri-Lending with Earth Intelligence
Eightco Holdings Inc. Announces Nasdaq Ticker Symbol Change to ORBS, Advancing the AI Revolution
TAGGED: the5.5-inchadditionall-in-oneallinoneannouncesaugboostcamerachinacombinesdevicedisplayefficiencyfilmgroundbreakinghighdefinitionhollylandinchlatestlaunchlineupmonitormultifunctionalnewsproductionprofessionalproudlypyroscreenseriesshenzhenunveilswireless
Share This Article
Facebook Copy Link Print
- Advertisement -

Your Trusted Source for Accurate and Timely Updates!

Our commitment to accuracy, impartiality, and delivering breaking news as it happens has earned us the trust of a vast audience. Stay ahead with real-time updates on the latest events, trends.
FacebookLike
XFollow
PinterestPin
InstagramFollow
YoutubeSubscribe
LinkedInFollow
MediumFollow

Most Selling Products

Top Picks, Trending Now – Discover the Best Sellers!
Tecno Camon 20 Premier 5G

Tecno Camon 20 Premier 5G

Dark Welkin | 8GB RAM + 512GB Storage (Expandable RAM up to 16GB) | Industry’s 1st 50MP RGBW-Pro Camera | Segment-First 108MP Ultra-Wide Macro Lens | 6.67" 120Hz 10-bit AMOLED In-Display

iQOO Z10 Lite 5G

iQOO Z10 Lite 5G

Titanium Blue | 6GB RAM + 128GB Storage | Dimensity 6300 5G with 433K+ AnTuTu Score | Robust 6000mAh Battery | IP64 Rated + Military-Grade Shock Resistance

OnePlus 13s

OnePlus 13s

Black Velvet | 12GB RAM + 256GB Storage | Flagship Snapdragon® 8 Elite Chipset | Exceptional Battery Life in a Compact Form | Lifetime Display Warranty Included

Samsung Galaxy A55 5G

Samsung Galaxy A55 5G

Awesome Iceblue | 8GB RAM + 256GB Storage | Premium Metal Frame | 50MP OIS Main Camera with Nightography | IP67 Water & Dust Resistance | Gorilla Glass Victus+ | sAMOLED Display with Vision Booster

You Might Also Like

U. S. Air Force Global Strike Command Reinstates the M18 Pistol
News

U. S. Air Force Global Strike Command Reinstates the M18 Pistol

28/08/2025
Artmarket.com news: Artprice launches Artprice News, the world’s first news agency entirely dedicated to art and its market, available in 11 languages and 122 countries, with Cision PR Newswire and Perplexity AI
Entertainment

Artmarket.com news: Artprice launches Artprice News, the world’s first news agency entirely dedicated to art and its market, available in 11 languages and 122 countries, with Cision PR Newswire and Perplexity AI

14/11/2025
Kenstar Brings Comfort, Style, and Savings to Festive Celebrations
Travel

Kenstar Brings Comfort, Style, and Savings to Festive Celebrations

30/09/2025
EatProtein Launches New Plant Based (Vegan) Protein Powder Specifically Designed for Womens Wellness
Sports

EatProtein Launches New Plant Based (Vegan) Protein Powder Specifically Designed for Womens Wellness

06/07/2025
Life Care News
Facebook Twitter Youtube Rss Medium

Life Care News:


We increase the awareness of millions of users through our news networks. We are one of the most trusted news networks in the world.

Top Categories
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Usefull Links
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Copyright © 2015 – 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Life Care NewsLife Care News
Copyright © 2015 - 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?