Saturday, 10 Jan 2026
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Subscribe
Life Care News
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
    NewsShow More
    World Customs Organization praises ‘e-commerce platform’ in trilingual report
    World Customs Organization praises ‘e-commerce platform’ in trilingual report
    31/12/2025
    Shri Acharya Devvrat, Governor of Gujarat, and Union Ministers Shri Kinjarapu Ram Mohan Naidu & Gajendra Singh Shekhawat Grace Namotsav at Sanskardham
    Shri Acharya Devvrat, Governor of Gujarat, and Union Ministers Shri Kinjarapu Ram Mohan Naidu & Gajendra Singh Shekhawat Grace Namotsav at Sanskardham
    31/12/2025
    International Forum “Problem-Solving City: Hong Kong as a Disputes Resolver”
    International Forum “Problem-Solving City: Hong Kong as a Disputes Resolver”
    28/12/2025
    Roca Group opens the Roca Delhi Gallery, its first in India, as part of its international network of design-led cultural spaces
    Roca Group opens the Roca Delhi Gallery, its first in India, as part of its international network of design-led cultural spaces
    28/12/2025
    Confidence Surges Among Small Enterprises Despite Global Headwinds, Reflecting India’s Strong Economic Momentum – ASSOCHAM Dun & Bradstreet Small Business Confidence Index
    Confidence Surges Among Small Enterprises Despite Global Headwinds, Reflecting India’s Strong Economic Momentum – ASSOCHAM Dun & Bradstreet Small Business Confidence Index
    27/12/2025
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
  • 🔥
  • news
  • global
  •  and
  •  the
  • announced
  • today
  • Business
  • Tech
  •  for
  • will
Font ResizerAa
Life Care NewsLife Care News
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Search
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Follow US
© 2022 Foxiz News Network. Ruby Design Company. All Rights Reserved.
Health

Axtria Recognized as Leading AI Service Provider with Minsky Award at Cypher 2025

PRNW Agency
Last updated: 27/09/2025 3:32 AM
PRNW Agency
Share
4 Min Read
Axtria Recognized as Leading AI Service Provider with Minsky Award at Cypher 2025
SHARE
Axtria Recognized as Leading AI Service Provider with Minsky Award at Cypher 2025

NEW DELHI, Sept. 26, 2025 /PRNewswire/ — Axtria Inc., a global leader in AI-first data analytics solutions for the life sciences industry, has been honored with the prestigious Minsky Award for Leading AI Service Provider at Cypher 2025, India’s largest AI conference. The recognition celebrates Axtria’s pioneering use of artificial intelligence, data science, and advanced analytics to accelerate innovation and deliver transformative solutions for life sciences organizations worldwide.

- Advertisement -

“This award is a testament to Axtria’s continued focus on driving meaningful impact through AI-led innovation. Our teams are constantly pushing boundaries to ensure life sciences organizations can harness data and advanced technologies to improve business outcomes and, ultimately, patient lives,” said Manish Mittal, Managing Principal and Country Head of India at Axtria.

- Advertisement -

As part of the conference, Manish Mittal also moderated a high-profile panel discussion on the theme “Will GCCs in India Evolve into AI-Powered Innovation Hubs or Be Sidelined by Autonomous Agent Platforms?” The conversation brought together industry leaders to explore the future of Global Capability Centers (GCCs) in India and their role in the rapidly maturing AI ecosystem.

- Advertisement -

Cypher 2025, organized by Analytics India Magazine (AIM), was held from September 17–19 in Bengaluru. The Minsky Awards, presented exclusively at the organizational level, are among the country’s most coveted honors in AI, spotlighting excellence and leadership in applying artificial intelligence to solve complex business challenges.

- Advertisement -

The recognition builds on Axtria’s growing track record of accolades in the AI space and underscores the company’s commitment to leveraging next-generation technologies to power innovation and deliver value for clients globally.

- Advertisement -

For more information about how Axtria can support your organization’s Agentic AI journey, please visit www.axtria.com.

- Advertisement -

About Axtria’s Products and Solutions

- Advertisement -

Axtria is proud to work with 16 of the top 20 life sciences companies globally. From our roots as a trusted consultant to our status as one of the world’s leading providers of cloud-based pharmaceutical management software, Axtria powers digital transformations in life sciences. Our experts call upon years of domain experience in the industry to guide pharma giants from brand launches to retirement. Our products go even further. Axtria InsightsMAx.ai is our agentic platform, featuring more than 30 agents, apps, and APIs, along with a full experimentation environment to find the perfect solution for unique business challenges. Axtria SalesIQ™ helps optimize field forces and provider engagements. Axtria CustomerIQ™ leverages AI-enabled next-best-action omnichannel choices. Axtria MarketingIQ™ turns investment analyses into pinpoint strategies. And Axtria DataMAx™ and DataMAx™ for Emerging Pharma is the data management framework that pulls it all together with best-in-class security and integration. 

- Advertisement -

About Axtria

- Advertisement -

Axtria helps life sciences companies harness the potential of data science and software to improve patient outcomes by connecting the right therapies to the right patients at the right time. The company is a leading global provider of award-winning cloud software and data analytics to the life sciences industry. We’re proud to deliver proven solutions that help pharmaceutical, medical device, and diagnostics companies complete their journey from data to insights to action, enabling them to earn superior returns on their investments. As a participant in the United Nations Global Compact, Axtria is committed to aligning strategies and operations with universal principles on human rights, labor, environment, and anti-corruption, and taking actions that advance societal goals. For more information, please visit www.axtria.com.

- Advertisement -

Logo – https://mma.prnewswire.com/media/2256316/Axtria_transparent_bg_Logo.jpg

- Advertisement -

View original content:https://www.prnewswire.com/in/news-releases/axtria-recognized-as-leading-ai-service-provider-with-minsky-award-at-cypher-2025-302568161.html

- Advertisement -
Rocket Doctor Grants RSUs and Stock Options
Harry Potter ‘Back to Hogwarts’ 2025 Celebrations Revealed
GENESIS MOTOR UK ANNOUNCES OHME AS ITS OFFICIAL HOME EV CHARGING PARTNER
World Peace Concert SOUND OF PEACE: International Benefit Concert for Peace to Take Place for the First Time in Front of the Iconic St. Peter’s Square
Zoomlion Advances Global Localization Through Community Action, Building Trust with Care and Long-Term Commitment
TAGGED: with2025advancedaifirstanalyticsawardaxtriaaxtriasconferencecypherdatadelhigccsglobalhonoredincindia:industryInnovationleaderleadinglifemanishminskymittalnewsorganizationsprestigiousproviderrecognizedsciencesseptservicesolutions
Share This Article
Facebook Copy Link Print
- Advertisement -

Your Trusted Source for Accurate and Timely Updates!

Our commitment to accuracy, impartiality, and delivering breaking news as it happens has earned us the trust of a vast audience. Stay ahead with real-time updates on the latest events, trends.
FacebookLike
XFollow
PinterestPin
InstagramFollow
YoutubeSubscribe
LinkedInFollow
MediumFollow

Most Selling Products

Top Picks, Trending Now – Discover the Best Sellers!
Tecno Camon 20 Premier 5G

Tecno Camon 20 Premier 5G

Dark Welkin | 8GB RAM + 512GB Storage (Expandable RAM up to 16GB) | Industry’s 1st 50MP RGBW-Pro Camera | Segment-First 108MP Ultra-Wide Macro Lens | 6.67" 120Hz 10-bit AMOLED In-Display

iQOO Z10 Lite 5G

iQOO Z10 Lite 5G

Titanium Blue | 6GB RAM + 128GB Storage | Dimensity 6300 5G with 433K+ AnTuTu Score | Robust 6000mAh Battery | IP64 Rated + Military-Grade Shock Resistance

OnePlus 13s

OnePlus 13s

Black Velvet | 12GB RAM + 256GB Storage | Flagship Snapdragon® 8 Elite Chipset | Exceptional Battery Life in a Compact Form | Lifetime Display Warranty Included

Samsung Galaxy A55 5G

Samsung Galaxy A55 5G

Awesome Iceblue | 8GB RAM + 256GB Storage | Premium Metal Frame | 50MP OIS Main Camera with Nightography | IP67 Water & Dust Resistance | Gorilla Glass Victus+ | sAMOLED Display with Vision Booster

You Might Also Like

Euro NCAP announces 2026 protocol changes to tackle modern driving risks

26/11/2025
Natural History Museum Abu Dhabi to Open in Saadiyat Cultural District on 22 November
Entertainment

Natural History Museum Abu Dhabi to Open in Saadiyat Cultural District on 22 November

23/10/2025
From Grandstand to Every Person: Sting Makes F1 Dream a Reality for Fans
Entertainment

From Grandstand to Every Person: Sting Makes F1 Dream a Reality for Fans

25/10/2025
Zuellig Pharma Unveils State-of-the-art Clinical Trial Support Innovation Center in South Korea to Support both Domestic and Global Clinical Research Needs
Health

Zuellig Pharma Unveils State-of-the-art Clinical Trial Support Innovation Center in South Korea to Support both Domestic and Global Clinical Research Needs

02/12/2025
Life Care News
Facebook Twitter Youtube Rss Medium

Life Care News:


We increase the awareness of millions of users through our news networks. We are one of the most trusted news networks in the world.

Top Categories
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Usefull Links
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Copyright © 2015 – 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Life Care NewsLife Care News
Copyright © 2015 - 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?