Friday, 9 Jan 2026
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Subscribe
Life Care News
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
    NewsShow More
    World Customs Organization praises ‘e-commerce platform’ in trilingual report
    World Customs Organization praises ‘e-commerce platform’ in trilingual report
    31/12/2025
    Shri Acharya Devvrat, Governor of Gujarat, and Union Ministers Shri Kinjarapu Ram Mohan Naidu & Gajendra Singh Shekhawat Grace Namotsav at Sanskardham
    Shri Acharya Devvrat, Governor of Gujarat, and Union Ministers Shri Kinjarapu Ram Mohan Naidu & Gajendra Singh Shekhawat Grace Namotsav at Sanskardham
    31/12/2025
    International Forum “Problem-Solving City: Hong Kong as a Disputes Resolver”
    International Forum “Problem-Solving City: Hong Kong as a Disputes Resolver”
    28/12/2025
    Roca Group opens the Roca Delhi Gallery, its first in India, as part of its international network of design-led cultural spaces
    Roca Group opens the Roca Delhi Gallery, its first in India, as part of its international network of design-led cultural spaces
    28/12/2025
    Confidence Surges Among Small Enterprises Despite Global Headwinds, Reflecting India’s Strong Economic Momentum – ASSOCHAM Dun & Bradstreet Small Business Confidence Index
    Confidence Surges Among Small Enterprises Despite Global Headwinds, Reflecting India’s Strong Economic Momentum – ASSOCHAM Dun & Bradstreet Small Business Confidence Index
    27/12/2025
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
  • 🔥
  • news
  • global
  •  and
  •  the
  • announced
  • today
  • Business
  • Tech
  •  for
  • will
Font ResizerAa
Life Care NewsLife Care News
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Search
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Follow US
© 2022 Foxiz News Network. Ruby Design Company. All Rights Reserved.
Business

Bajaj Group Pays Tribute to its Founder Shri Jamnalal Bajaj on His 136th Birth Anniversary

News Voir
Last updated: 08/11/2025 11:33 PM
News Voir
Share
4 Min Read
Bajaj Group Pays Tribute to its Founder Shri Jamnalal Bajaj on His 136th Birth Anniversary
SHARE
Bajaj Group Pays Tribute to its Founder Shri Jamnalal Bajaj on His 136th Birth Anniversary

On the occasion of the 136th birth anniversary of Shri Jamnalal Bajaj (1889–1942), the Bajaj Group, under the leadership of Chairman Shri Kushagra Bajaj and Shri Shishir Bajaj, released a special commemorative video celebrating the life and legacy of its illustrious founder, a man whose humility, courage and purpose continue to define India’s moral and industrial spirit even today.
 

- Advertisement -

The short film, titled “The Spirit of Self-Reliant India,” traces the remarkable journey of Shri Jamnalal Bajaj from his humble beginnings in Kashi Ka Baas village of Sikar, Rajasthan, to his transformative meeting with Mahatma Gandhi in 1915, and his lifelong commitment to India’s freedom, Swadeshi, Khadi, and nation-building.
 

- Advertisement -

“Shri Jamnalal Bajaj was not just a successful industrialist – he was a visionary patriot who lived for the country’s progress and self-reliance,” said Shri Kushagra Bajaj, the great grandson of Late Shri Jamnalal Bajaj.

- Advertisement -

“As we remember him today, we rededicate ourselves to the same values of integrity, innovation and service that he stood for. His ideals continue to inspire every generation of the Bajaj family and businesses.”
 

- Advertisement -

The tribute video highlights key milestones from his extraordinary life

- Advertisement -
  • His adoption by Seth Bachhraj of Wardha, Maharashtra which set him on the path of trade and entrepreneurship.

  • His close association with Mahatma Gandhi, who affectionately called him “his fifth son.”

  • His leadership in promoting Khadi, Swadeshi, and equality, including the historic moment when he opened the doors of the Laxminarayan Temple in Wardha to the untouchables first time in India.

  • His establishment of first Indian-owned full-fledged sugar mill at Gola Gokarannath, Uttar Pradesh in 1931, a milestone that laid the foundation for India’s modern sugar industry and embodied the essence of Aatmanirbhar Bharat.

  • His donation of land in Wardha for Sevagram Ashram, where Gandhiji lived from 1936-1948, became a nucleus of India’s freedom movement.
    .

Speaking on the occasion, Shri Shishir Bajaj remarked, “My Grandfather Jamnalal ji’s life was his message, simple living, fearless service and unwavering faith in India’s potential. His contribution to industry, equality, and nation-building continues to inspire our collective vision at the Bajaj Group.”
 

- Advertisement -

The video closes with a powerful reminder that true freedom begins with self-reliance and service to others, a principle that continues to guide every Bajaj enterprise today.
 

- Advertisement -

Shri Jamnalal Bajaj’s enduring values of truth, simplicity, compassion, and nationalism remain at the heart of the Bajaj Group’s philosophy, a legacy that spans nearly a century of service to India through industries, institutions and philanthropy.
 

- Advertisement -

Watch the commemorative film here: www.youtube.com/shorts/pb-J_zy78pY
 

- Advertisement -

About Bajaj Group
Founded by Shri Jamnalal Bajaj in 1926, the Bajaj Group is among India’s oldest and most respected conglomerates, with interests in sugar, energy, FMCG, philanthropy and more. Rooted in Gandhian ideals and driven by a commitment to nation-building, the Group continues to uphold its founder’s vision of an Aatmanirbhar Bharat through innovation, ethical leadership, and community development.

- Advertisement -
Individual Neutral Athletes to compete at Milano Cortina 2026 Olympic Winter Games under same conditions as for Paris 2024
Italian Leading Fashion Group OVS to open its store in New Delhi
Saudi Arabia to Host the 11th Ministerial Conference of Least Developed Countries (LDCMC11) in November
ORYZON to Participate in Upcoming Events in September and October
Hydreight Reports 132% YoY Revenue Increase in Q3 2025 and Fourth Consecutive Quarter of Profitability, Highlighting Strong Multi-Vertical Performance
TAGGED:136thanniversarybajajbirthcelebratingchairmancommemorativecontinuecouragedefinefoundergrouphishumilityillustriousindia’sits jamnalalkushagraleadershiplegacylifemannewsoccasionpayspurposereleasedshishirshrispecialspirittodaytributevideowhose
Share This Article
Facebook Copy Link Print
- Advertisement -

Your Trusted Source for Accurate and Timely Updates!

Our commitment to accuracy, impartiality, and delivering breaking news as it happens has earned us the trust of a vast audience. Stay ahead with real-time updates on the latest events, trends.
FacebookLike
XFollow
PinterestPin
InstagramFollow
YoutubeSubscribe
LinkedInFollow
MediumFollow

Most Selling Products

Top Picks, Trending Now – Discover the Best Sellers!
Tecno Camon 20 Premier 5G

Tecno Camon 20 Premier 5G

Dark Welkin | 8GB RAM + 512GB Storage (Expandable RAM up to 16GB) | Industry’s 1st 50MP RGBW-Pro Camera | Segment-First 108MP Ultra-Wide Macro Lens | 6.67" 120Hz 10-bit AMOLED In-Display

iQOO Z10 Lite 5G

iQOO Z10 Lite 5G

Titanium Blue | 6GB RAM + 128GB Storage | Dimensity 6300 5G with 433K+ AnTuTu Score | Robust 6000mAh Battery | IP64 Rated + Military-Grade Shock Resistance

OnePlus 13s

OnePlus 13s

Black Velvet | 12GB RAM + 256GB Storage | Flagship Snapdragon® 8 Elite Chipset | Exceptional Battery Life in a Compact Form | Lifetime Display Warranty Included

Samsung Galaxy A55 5G

Samsung Galaxy A55 5G

Awesome Iceblue | 8GB RAM + 256GB Storage | Premium Metal Frame | 50MP OIS Main Camera with Nightography | IP67 Water & Dust Resistance | Gorilla Glass Victus+ | sAMOLED Display with Vision Booster

You Might Also Like

Saviynt Inaugurates Its Largest Global Innovation Hub in Bengaluru to Power the Future of AI-Driven Identity Security
Business

Saviynt Inaugurates Its Largest Global Innovation Hub in Bengaluru to Power the Future of AI-Driven Identity Security

08/10/2025
IIM Calcutta launches Advanced Programme in Smart Manufacturing Leadership to drive India’s Industry 4.0 revolution
News

IIM Calcutta launches Advanced Programme in Smart Manufacturing Leadership to drive India’s Industry 4.0 revolution

13/08/2025
Nxera Pharma to Receive US.8 Million in Milestone Payments Following Centessas Initiation of Clinical Development of ORX142, a Novel Orexin Receptor 2 (OX2R) Agonist
Health

Nxera Pharma to Receive US$4.8 Million in Milestone Payments Following Centessas Initiation of Clinical Development of ORX142, a Novel Orexin Receptor 2 (OX2R) Agonist

04/07/2025
Astral Bathware Unveils Its Brand Film Showcasing ‘Engineered with Elegance’
Food

Astral Bathware Unveils Its Brand Film Showcasing ‘Engineered with Elegance’

21/11/2025
Life Care News
Facebook Twitter Youtube Rss Medium

Life Care News:


We increase the awareness of millions of users through our news networks. We are one of the most trusted news networks in the world.

Top Categories
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Usefull Links
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Copyright © 2015 – 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Life Care NewsLife Care News
Copyright © 2015 - 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?