Sunday, 31 Aug 2025
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Subscribe
Life Care News
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
    NewsShow More
    Bybit x Santiment DeFi Report: Platform Tokens Shine As MNT Sees Over M Whale Transactions
    Bybit x Santiment DeFi Report: Platform Tokens Shine As MNT Sees Over $1M Whale Transactions
    30/08/2025
    Wonderful Indonesia Shines at ITB India 2025: From Bali to Beyond
    Wonderful Indonesia Shines at ITB India 2025: From Bali to Beyond
    30/08/2025
    Rethink Light, Reimagine Style — Olight Unveils ArkPro Series with Groundbreaking Pure Flood
    Rethink Light, Reimagine Style — Olight Unveils ArkPro Series with Groundbreaking Pure Flood
    29/08/2025
    Arclin Enters into Definitive Agreement to Acquire Aramids Business, including Kevlar and Nomex Brands, from DuPont
    Arclin Enters into Definitive Agreement to Acquire Aramids Business, including Kevlar and Nomex Brands, from DuPont
    29/08/2025
    Jockey Club unveils first Hong Kong, China member of global pop group Now United, supporting young local talent to shine on world stage
    Jockey Club unveils first Hong Kong, China member of global pop group Now United, supporting young local talent to shine on world stage
    29/08/2025
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
  • 🔥
  • news
  • june
  • global
  • Business
  • july
  • today
  • announced
  • aug
  • company
  • Tech
Font ResizerAa
Life Care NewsLife Care News
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Search
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Follow US
© 2022 Foxiz News Network. Ruby Design Company. All Rights Reserved.
Health

Lifecykel Launches Ground Breaking Mongolian Training Program with UFC Legends Jorge Masvidal and Batgerel Danaa

PRNW Agency
Last updated: 12/07/2025 9:19 PM
PRNW Agency
Share
5 Min Read
Lifecykel Launches Ground Breaking Mongolian Training Program with UFC Legends Jorge Masvidal and Batgerel Danaa
SHARE
Lifecykel Launches Ground Breaking Mongolian Training Program with UFC Legends Jorge Masvidal and Batgerel Danaa

ULAANBAATAR, Mongolia, July 10, 2025 /PRNewswire/ — UFC legend Jorge Masvidal, famously known as the “King of Miami,” and Mongolian MMA icon Batgerel Danaa are teaming up for a new chapter in elite human performance. The two fighters are working alongside Lifecykel to lead a high-performance training initiative in Mongolia, united by a shared philosophy: the destruction of weakness in all areas of life.

- Advertisement -

The program, titled Eat and Train Like Genghis Khan, is developed by Lifecykel Labs and immerses participants in authentic Mongolian strength training and nutritional practices. This unique performance experience is fueled by a curated selection of powerful local superfoods, including Mongolian Shilajit and Sea Buckthorn Oil—natural ingredients long treasured for their endurance-enhancing and restorative properties.

- Advertisement -

Designed for high achievers and self-optimizers, the camp invites individuals dedicated to growth, discipline, and physical excellence. At the heart of the program is Shilajit, a cornerstone of traditional Mongolian wellness, often referred to as “the destroyer of weakness” for its dense mineral profile and adaptogenic power. Danaa has developed a signature training regimen that merges ancient warrior techniques with cutting-edge biohacking strategies. Those interested in participating in future camps can inquire via email at mongolia@lifecykel.com.

Coinciding with Mongolia’s famed Naadam Festival, the inaugural camp offers more than just elite fitness—it places participants within a deep cultural tradition. Celebrated nationwide, Naadam features wrestling, archery, horse racing, and ceremonies that reflect Mongolia’s rich heritage. The camp is set against the breathtaking backdrop of the Mongolian steppe, offering an unforgettable intersection of ancient strength and modern science.

- Advertisement -

About the Partners

- Advertisement -

Lifecykel
Lifecykel Labs is a worldwide leader in elite performance, biohacking, and longevity. Operating in over 120 countries with a digital following of more than 500,000, Lifecykel is known for its science-backed health innovations. Its signature Biohacker Set gained international recognition after being spotlighted by podcasting legend Joe Rogan and biohacking pioneer Dave Asprey. As performance-tracking technologies like WHOOP become more mainstream, Lifecykel is at the forefront of a new wave in data-driven supplementation. Most recently, the brand launched its Destroyer of Weakness longevity partnership with professional rugby team the Chicago Hounds, who narrowly missed the finals after a standout season. First time customers are still able to make use of the special partnership discount code HOUNDS20 when checking out on the Lifecykel website.

lifecykel.com

- Advertisement -

Lifecykel Instagram

- Advertisement -

Jorge Masvidal
Jorge Masvidal, born November 12, 1984, in Miami, Florida, is a retired American mixed martial artist and professional boxer with Cuban and Peruvian roots. He rose to fame in the early 2000s through street fighting videos and went on to compete in Bellator, Strikeforce, and ultimately the UFC. Masvidal made history with the fastest knockout in UFC history—just five seconds—and earned the sport’s symbolic BMF (Baddest Motherf*****) title. Since retiring in 2023, he has stayed active in combat sports through professional boxing and by founding the Gamebred Fighting Championship, a bare-knuckle MMA promotion.

Masvidal Instagram

- Advertisement -

Masvidal x Lifecykel Post

- Advertisement -

Batgerel Danaa
Born July 4, 1989, in Erdenetsagaan, Mongolia, Batgerel Danaa is a celebrated professional mixed martial artist in the bantamweight division. He began kickboxing in 2007 and entered MMA professionally in 2011. After achieving a 7–1 record, he joined the UFC, where he delivered several memorable performances, including knockouts against Guido Cannetti and Kevin Natividad. His victory over Brandon Davis earned him UFC’s Performance of the Night honor. Danaa holds a professional MMA record of 12 wins and 5 losses and is revered as a national sports hero in Mongolia.

Danaa Instagram

- Advertisement -

Contact:
For media inquiries or interest in future camps, please contact:
mongolia@lifecykel.com

- Advertisement -

Photo – https://mma.prnewswire.com/media/2728362/UFC_Legend_Jorge_Masvidal_During_Lifecykel_Elite_Performance_Training.jpg

View original content:https://www.prnewswire.co.uk/news-releases/lifecykel-launches-ground-breaking-mongolian-training-program-with-ufc-legends-jorge-masvidal-and-batgerel-danaa-302502084.html

- Advertisement -
ACES Signs Landmark Agreement with BMRCL to Build 4G/5G-Ready Neutral Host Telecom Infrastructure Across Namma Metro
Newest Innovation in Protein: Proathlix’s 9-Source Protein Blend with Veg Collagen Peptide
Nokia Corporation – Managers’ transactions (Fisk)
Enovix Shareholder Second Reminder: Early Warrant Expiration Price Condition
Kia Tasman Blazes New Trail for Pickup Truck Segment with Exceptional OffRoad Ability
TAGGED: and withbatgerelbreakingchapterdanaadevelopedelitefamouslyfightersgroundhumaniconjorgejulykingknownlauncheslegendlegendslifecykelmasvidalmiamimmamongoliamongoliannewsperformanceprogramshilajitteamingtrainingtwoufculaanbaatarweaknessworking
Share This Article
Facebook Copy Link Print
- Advertisement -

Your Trusted Source for Accurate and Timely Updates!

Our commitment to accuracy, impartiality, and delivering breaking news as it happens has earned us the trust of a vast audience. Stay ahead with real-time updates on the latest events, trends.
FacebookLike
XFollow
PinterestPin
InstagramFollow
YoutubeSubscribe
LinkedInFollow
MediumFollow

Most Selling Products

Top Picks, Trending Now – Discover the Best Sellers!
Tecno Camon 20 Premier 5G

Tecno Camon 20 Premier 5G

Dark Welkin | 8GB RAM + 512GB Storage (Expandable RAM up to 16GB) | Industry’s 1st 50MP RGBW-Pro Camera | Segment-First 108MP Ultra-Wide Macro Lens | 6.67" 120Hz 10-bit AMOLED In-Display

iQOO Z10 Lite 5G

iQOO Z10 Lite 5G

Titanium Blue | 6GB RAM + 128GB Storage | Dimensity 6300 5G with 433K+ AnTuTu Score | Robust 6000mAh Battery | IP64 Rated + Military-Grade Shock Resistance

OnePlus 13s

OnePlus 13s

Black Velvet | 12GB RAM + 256GB Storage | Flagship Snapdragon® 8 Elite Chipset | Exceptional Battery Life in a Compact Form | Lifetime Display Warranty Included

Samsung Galaxy A55 5G

Samsung Galaxy A55 5G

Awesome Iceblue | 8GB RAM + 256GB Storage | Premium Metal Frame | 50MP OIS Main Camera with Nightography | IP67 Water & Dust Resistance | Gorilla Glass Victus+ | sAMOLED Display with Vision Booster

You Might Also Like

GENESIS MOTOR UK DEBUTS ENHANCED GV60

11/07/2025
Infosys Collaborates with AGCO to Deliver IT and HR Operations Transformation
Business

Infosys Collaborates with AGCO to Deliver IT and HR Operations Transformation

22/07/2025
UST Expands India Presence with Two New Offices in Delhi NCR
Business

UST Expands India Presence with Two New Offices in Delhi NCR

04/06/2025
Vantage Foundation Partners with Blue Dragon Children’s Foundation to Protect Children and Prevent Human Trafficking
Business

Vantage Foundation Partners with Blue Dragon Children’s Foundation to Protect Children and Prevent Human Trafficking

15/08/2025
Life Care News
Facebook Twitter Youtube Rss Medium

Life Care News:


We increase the awareness of millions of users through our news networks. We are one of the most trusted news networks in the world.

Top Categories
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Usefull Links
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Copyright © 2015 – 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Life Care NewsLife Care News
Copyright © 2015 - 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?