Sunday, 11 Jan 2026
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Subscribe
Life Care News
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
    NewsShow More
    World Customs Organization praises ‘e-commerce platform’ in trilingual report
    World Customs Organization praises ‘e-commerce platform’ in trilingual report
    31/12/2025
    Shri Acharya Devvrat, Governor of Gujarat, and Union Ministers Shri Kinjarapu Ram Mohan Naidu & Gajendra Singh Shekhawat Grace Namotsav at Sanskardham
    Shri Acharya Devvrat, Governor of Gujarat, and Union Ministers Shri Kinjarapu Ram Mohan Naidu & Gajendra Singh Shekhawat Grace Namotsav at Sanskardham
    31/12/2025
    International Forum “Problem-Solving City: Hong Kong as a Disputes Resolver”
    International Forum “Problem-Solving City: Hong Kong as a Disputes Resolver”
    28/12/2025
    Roca Group opens the Roca Delhi Gallery, its first in India, as part of its international network of design-led cultural spaces
    Roca Group opens the Roca Delhi Gallery, its first in India, as part of its international network of design-led cultural spaces
    28/12/2025
    Confidence Surges Among Small Enterprises Despite Global Headwinds, Reflecting India’s Strong Economic Momentum – ASSOCHAM Dun & Bradstreet Small Business Confidence Index
    Confidence Surges Among Small Enterprises Despite Global Headwinds, Reflecting India’s Strong Economic Momentum – ASSOCHAM Dun & Bradstreet Small Business Confidence Index
    27/12/2025
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
  • 🔥
  • news
  • global
  •  and
  •  the
  • announced
  • today
  • Business
  • Tech
  •  for
  • will
Font ResizerAa
Life Care NewsLife Care News
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Search
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Follow US
© 2022 Foxiz News Network. Ruby Design Company. All Rights Reserved.
Business

NYSE Content Advisory: Pre-Market Update + Alphabet shares pop 7% to lift S&P 500

PRNW Agency
Last updated: 04/09/2025 3:31 AM
PRNW Agency
Share
1 Min Read
SHARE

NEW YORK, Sept. 3, 2025 /PRNewswire/ — The New York Stock Exchange (NYSE) provides a daily pre-market update directly from the NYSE Trading Floor. Access today’s NYSE Pre-market update for market insights before trading begins. 

- Advertisement -

Kristen Scholer delivers the pre-market update on September 3rd

- Advertisement -
  • Shares of Alphabet rose by 7% after a judge ruled that the company can keep its Chrome browser but must share its data and cannot enter exclusive search deals.
  • Bond prices fell after a federal appeals court ruled that many of President Donald Trump’s tariffs are illegal. This decision could force the U.S. to return billions of dollars accrued from trade levies.
  • The next major focus for traders is the upcoming jobs report, with economists anticipating that 75,000 jobs were added in August 4.

Opening Bell
PulteGroup (NYSE: PHM) celebrates the delivery of its 100th Built to Honor home

- Advertisement -

Closing Bell
Clearwater Analytics (NYSE: CWAN) marks its investor day

- Advertisement -

Click here to download the NYSE TV App

- Advertisement -

 

- Advertisement -

Video – https://mma.prnewswire.com/media/2763669/NYSE_Sept_3_Market_Update.mp4
Logo – https://mma.prnewswire.com/media/2581322/New_York_Stock_Exchange_Logo.jpg 

- Advertisement -

View original content:https://www.prnewswire.co.uk/news-releases/nyse-content-advisory-pre-market-update–alphabet-shares-pop-7-to-lift-sp-500-302545178.html

- Advertisement -
Yatra Celebrates 19 Years with The Yatra Big Outing Fest
NYSE Content Advisory: Pre-Market Update + ICE to Invest up to $2 Billion in Polymarket
New Report from BCG and Vestiaire Collective Reveals Global Trends Reshaping the Resale Market
Emirates Logistics embarks on Kenya expansion at Tatu City SEZ
Herbalife India Launches New Episode of Its Flagship Podcast Featuring Paralympian Palak Kohli Live Your Best Life, Unscripted: A Story of Grit, Purpose & Sporting Excellence
TAGGED:500accessadvisoryalphabetbeforebeginsbellpultegroupbuiltcelebratescontentdailydeliversdeliverydirectlyexchangefloorhomehonorinsightskristenliftmarketnewsnyseopeningphmpoppre-marketpremarketprovidess&pscholerseptseptembersharesstocktoday’stradingupdateyork
Share This Article
Facebook Copy Link Print
- Advertisement -

Your Trusted Source for Accurate and Timely Updates!

Our commitment to accuracy, impartiality, and delivering breaking news as it happens has earned us the trust of a vast audience. Stay ahead with real-time updates on the latest events, trends.
FacebookLike
XFollow
PinterestPin
InstagramFollow
YoutubeSubscribe
LinkedInFollow
MediumFollow

Most Selling Products

Top Picks, Trending Now – Discover the Best Sellers!
Tecno Camon 20 Premier 5G

Tecno Camon 20 Premier 5G

Dark Welkin | 8GB RAM + 512GB Storage (Expandable RAM up to 16GB) | Industry’s 1st 50MP RGBW-Pro Camera | Segment-First 108MP Ultra-Wide Macro Lens | 6.67" 120Hz 10-bit AMOLED In-Display

iQOO Z10 Lite 5G

iQOO Z10 Lite 5G

Titanium Blue | 6GB RAM + 128GB Storage | Dimensity 6300 5G with 433K+ AnTuTu Score | Robust 6000mAh Battery | IP64 Rated + Military-Grade Shock Resistance

OnePlus 13s

OnePlus 13s

Black Velvet | 12GB RAM + 256GB Storage | Flagship Snapdragon® 8 Elite Chipset | Exceptional Battery Life in a Compact Form | Lifetime Display Warranty Included

Samsung Galaxy A55 5G

Samsung Galaxy A55 5G

Awesome Iceblue | 8GB RAM + 256GB Storage | Premium Metal Frame | 50MP OIS Main Camera with Nightography | IP67 Water & Dust Resistance | Gorilla Glass Victus+ | sAMOLED Display with Vision Booster

You Might Also Like

Gates Foundation Announces Catalytic Funding to Spark New Era of Women-Centered Research and Innovation
News

Gates Foundation Announces Catalytic Funding to Spark New Era of Women-Centered Research and Innovation

04/08/2025
Akums Reports Q4 FY25 with 12.4% Revenue Growth, FY25 Adj. EBITDA Remained Strong at 12.3%
Health

Akums Reports Q4 FY25 with 12.4% Revenue Growth, FY25 Adj. EBITDA Remained Strong at 12.3%

18/10/2025
Formula 1 Etihad Airways Abu Dhabi Grand Prix brings 339,000 fans to Yas Island
News

Formula 1 Etihad Airways Abu Dhabi Grand Prix brings 339,000 fans to Yas Island

12/12/2025
B612 Foundation Announces Winner of Prestigious Schweickart Prize: Imperial College London’s Jordan Stone Leads Winning Proposal for International Panel on Asteroid Orbit Alteration, Recognized for its Foresight in Planetary Defense
Automobile

B612 Foundation Announces Winner of Prestigious Schweickart Prize: Imperial College London’s Jordan Stone Leads Winning Proposal for International Panel on Asteroid Orbit Alteration, Recognized for its Foresight in Planetary Defense

08/07/2025
Life Care News
Facebook Twitter Youtube Rss Medium

Life Care News:


We increase the awareness of millions of users through our news networks. We are one of the most trusted news networks in the world.

Top Categories
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Usefull Links
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Copyright © 2015 – 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Life Care NewsLife Care News
Copyright © 2015 - 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?