Friday, 10 Oct 2025
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Subscribe
Life Care News
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
    NewsShow More
    Fintech Forward 2025 Delivers with 38 Industry-Shaping Partnerships and Strategic Agreements Signed
    Fintech Forward 2025 Delivers with 38 Industry-Shaping Partnerships and Strategic Agreements Signed
    10/10/2025
    Kimberly-Clark Launches Enhanced Global Partnerships to Advance Essential Care for 24 Million Women and Girls
    Kimberly-Clark Launches Enhanced Global Partnerships to Advance Essential Care for 24 Million Women and Girls
    10/10/2025
    GEDU Group to Become Largest Foreign Education Investor in India
    GEDU Group to Become Largest Foreign Education Investor in India
    09/10/2025
    Signs of Change: Equipping Teachers with Tools for Inclusive Classrooms
    Signs of Change: Equipping Teachers with Tools for Inclusive Classrooms
    09/10/2025
    Nobel Prize 2025 in Medicine: Three Scientists Who Changed the Future of Immunology
    Nobel Prize 2025 in Medicine: Three Scientists Who Changed the Future of Immunology
    08/10/2025
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
  • 🔥
  • news
  • global
  • Business
  • june
  • announced
  • today
  •  and
  •  the
  • july
  • company
Font ResizerAa
Life Care NewsLife Care News
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Search
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Follow US
© 2022 Foxiz News Network. Ruby Design Company. All Rights Reserved.
Business

NYSE Content Advisory: Pre-Market update + NYSE co-creates ‘Taking Stock’ content series

PRNW Agency
Last updated: 04/06/2025 3:53 AM
PRNW Agency
Share
1 Min Read
SHARE

NEW YORK, June 3, 2025 /PRNewswire/ — The New York Stock Exchange (NYSE) provides a daily pre-market update directly from the NYSE Trading Floor. Access today’s NYSE Pre-market update for market insights before trading begins. 

- Advertisement -

J.D. Durkin delivers the pre-market update on Jun 3rd

- Advertisement -
  • The major averages are moving lower ahead of today’s open after the Organization for Economic Co-Operation and Development cut its economic forecast for the U.S. and globally in lieu of the recent tariff ramp-up.
  • Earlier today, at a leading financial technology conference in Amsterdam, the NYSE, in collaboration with Money 20/20, FINTECH TV, and Cheddar, announced a new content series called Taking Stock
  • The Taking Stock program will air weekdays, live from the NYSE trading floor, talking finance of the future. The first episode debuts in mid-August, distributed across all major platforms, and will be hosted by J.D. Durkin.

Click here to watch a preview of Taking Stock

- Advertisement -

Opening Bell
OLO (NYSE: OLO) celebrates its 20th anniversary

- Advertisement -

Closing Bell
Madrona celebrates the winners of the 2024 Madrona IA40 List

- Advertisement -

Video – https://mma.prnewswire.com/media/2702222/NYSE_Market_Update_June_3.mp4

- Advertisement -

Logo – https://mma.prnewswire.com/media/2581322/New_York_Stock_Exchange_Logo.jpg

- Advertisement -

View original content:https://www.prnewswire.co.uk/news-releases/nyse-content-advisory-pre-market-update–nyse-co-creates-taking-stock-content-series-302471966.html

- Advertisement -
Shepherd Partners with Intel to Enhance its Endpoint Protection Suite with Hardware-based Ransomware Detection
KFSHRC First in the Middle East to Implant AI-Powered Brain-Sensing Device for Treating Neurological Disorders
Orion Innovation Expands Leadership, Strengthens Strategic Cloud and AI Partnerships to Power Client Transformation
Unravel Data Launches Free Snowflake Native App for Cost and Performance Optimization on Snowflake Marketplace
SEMI Reports Global Semiconductor Equipment Billings Increased 21% Year-Over-Year in Q1 2025
TAGGED:accessbeforebeginsclickdailydeliversdirectlydurkinexchangefloorinsightsjunjunemarketnysepremarketpreviewprovidesstocktakingtoday’stradingupdatewatchyork
Share This Article
Facebook Copy Link Print
- Advertisement -

Your Trusted Source for Accurate and Timely Updates!

Our commitment to accuracy, impartiality, and delivering breaking news as it happens has earned us the trust of a vast audience. Stay ahead with real-time updates on the latest events, trends.
FacebookLike
XFollow
PinterestPin
InstagramFollow
YoutubeSubscribe
LinkedInFollow
MediumFollow

Most Selling Products

Top Picks, Trending Now – Discover the Best Sellers!
Tecno Camon 20 Premier 5G

Tecno Camon 20 Premier 5G

Dark Welkin | 8GB RAM + 512GB Storage (Expandable RAM up to 16GB) | Industry’s 1st 50MP RGBW-Pro Camera | Segment-First 108MP Ultra-Wide Macro Lens | 6.67" 120Hz 10-bit AMOLED In-Display

iQOO Z10 Lite 5G

iQOO Z10 Lite 5G

Titanium Blue | 6GB RAM + 128GB Storage | Dimensity 6300 5G with 433K+ AnTuTu Score | Robust 6000mAh Battery | IP64 Rated + Military-Grade Shock Resistance

OnePlus 13s

OnePlus 13s

Black Velvet | 12GB RAM + 256GB Storage | Flagship Snapdragon® 8 Elite Chipset | Exceptional Battery Life in a Compact Form | Lifetime Display Warranty Included

Samsung Galaxy A55 5G

Samsung Galaxy A55 5G

Awesome Iceblue | 8GB RAM + 256GB Storage | Premium Metal Frame | 50MP OIS Main Camera with Nightography | IP67 Water & Dust Resistance | Gorilla Glass Victus+ | sAMOLED Display with Vision Booster

You Might Also Like

ValueLabs Announces Plans to Become the Enterprise OS of the Agentic Era
Tech

ValueLabs Announces Plans to Become the Enterprise OS of the Agentic Era

17/06/2025
UFCW 8-Golden State Reaches Tentative Agreement with Raleys, Bel Air, and Nob HillThousands of Grocery Workers to Benefit
Business

UFCW 8-Golden State Reaches Tentative Agreement with Raleys, Bel Air, and Nob HillThousands of Grocery Workers to Benefit

13/09/2025
Swiggy and McDonald’s Join Hands to Launch the revolutionary McDonald’s Protein Plus Burgers exclusively on the Swiggy app
Business

Swiggy and McDonald’s Join Hands to Launch the revolutionary McDonald’s Protein Plus Burgers exclusively on the Swiggy app

27/07/2025
EURneffy (adrenaline nasal spray) Approved in the U.K. as the First and Only Needle-Free Emergency Treatment of Allergic Reactions (anaphylaxis)
Health

EURneffy (adrenaline nasal spray) Approved in the U.K. as the First and Only Needle-Free Emergency Treatment of Allergic Reactions (anaphylaxis)

18/07/2025
Life Care News
Facebook Twitter Youtube Rss Medium

Life Care News:


We increase the awareness of millions of users through our news networks. We are one of the most trusted news networks in the world.

Top Categories
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Usefull Links
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Copyright © 2015 – 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Life Care NewsLife Care News
Copyright © 2015 - 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?