Friday, 20 Feb 2026
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Subscribe
Life Care News
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
    NewsShow More
    World Customs Organization praises ‘e-commerce platform’ in trilingual report
    World Customs Organization praises ‘e-commerce platform’ in trilingual report
    31/12/2025
    Shri Acharya Devvrat, Governor of Gujarat, and Union Ministers Shri Kinjarapu Ram Mohan Naidu & Gajendra Singh Shekhawat Grace Namotsav at Sanskardham
    Shri Acharya Devvrat, Governor of Gujarat, and Union Ministers Shri Kinjarapu Ram Mohan Naidu & Gajendra Singh Shekhawat Grace Namotsav at Sanskardham
    31/12/2025
    International Forum “Problem-Solving City: Hong Kong as a Disputes Resolver”
    International Forum “Problem-Solving City: Hong Kong as a Disputes Resolver”
    28/12/2025
    Roca Group opens the Roca Delhi Gallery, its first in India, as part of its international network of design-led cultural spaces
    Roca Group opens the Roca Delhi Gallery, its first in India, as part of its international network of design-led cultural spaces
    28/12/2025
    Confidence Surges Among Small Enterprises Despite Global Headwinds, Reflecting India’s Strong Economic Momentum – ASSOCHAM Dun & Bradstreet Small Business Confidence Index
    Confidence Surges Among Small Enterprises Despite Global Headwinds, Reflecting India’s Strong Economic Momentum – ASSOCHAM Dun & Bradstreet Small Business Confidence Index
    27/12/2025
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
  • 🔥
  • news
  • global
  •  and
  •  the
  • announced
  • today
  • Business
  • Tech
  •  for
  • will
Font ResizerAa
Life Care NewsLife Care News
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Search
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Follow US
© 2022 Foxiz News Network. Ruby Design Company. All Rights Reserved.
Tech

Participate in Winner Mining cloud mining, earning BTC is no longer a dream

GlobeNews Wire
Last updated: 05/06/2025 4:52 AM
GlobeNews Wire
Share
5 Min Read
Participate in Winner Mining cloud mining, earning BTC is no longer a dream
SHARE
Participate in Winner Mining cloud mining, earning BTC is no longer a dream

Miami, Florida, June 04, 2025 (GLOBE NEWSWIRE) —

Faced with the evolving cryptocurrency market, global investors are actively seeking low-threshold, high-efficiency ways to participate in digital assets. Against this backdrop, the cloud mining platform WinnerMining is rapidly emerging as an important force in driving ordinary investors into the mainstream crypto asset ecosystem such as Bitcoin.

According to the latest forecast from digital asset analysis platform CoinCodex, Bitcoin could rise to $132,409 in the next five days, an increase of more than 26% from the current price. Although market volatility remains, many investors see it as a potential hedge against macroeconomic uncertainty.

In this trend, WinnerMining provides a new way to participate in the digital asset market through cloud mining, without the need to purchase hardware equipment or deal with technical maintenance issues, thus attracting a large number of ordinary users and entry-level investors.

What is WinnerMining ?

WinnerMining was founded in 2021 and currently has more than 100 data centers around the world. Its platform services cover more than 180 countries and regions, and it has more than 13 million registered users. Through cloud computing technology, users can remotely rent computing power and participate in the mining of mainstream currencies such as Bitcoin (BTC), Ethereum (ETH), Litecoin (LTC), Dogecoin (DOGE), and Ripple (XRP) .

The company said that its mining facilities are 100% powered by green energy to address the industry’s focus on sustainable development. The platform also has the regulatory qualifications of a British financial institution and provides network and asset security through McAfee and Cloudflare.

Why BTC investors are optimistic about WinnerMining :

  • § Register a new user to get $15, sign in daily to get $0.6
  • § The affiliate program allows users to earn referral rewards of up to 4.5% .
  • § One-click cloud mining technology , supporting mobile applications and PC operations
  • § Daily income is settled instantly to ensure users have high income every day .
  • § Supports flexible conversion of multiple digital currencies including BTC, ETH, LTC, BCH, USDT, DOGE , SOL and XRP.
  • § powered by green renewable energy , 100% renewable energy
  • § UK financial regulatory certification, 24-hour customer service, and fund security is guaranteed by McAfee and Cloudflare .

How to convert your BTC into daily income with WinnerMining :

Step 1 : Choose Winner Mining cloud mining service provider . The platform has a professional analysis team who will analyze the computing power generated by the operation of the mining machine and replace the latest mining machine in time to ensure that users get additional income and improve investment security .

Step 2: Choose the cryptocurrency contract that suits your potential income:

Investment Plans Contract Price Contract Term Daily income Total revenue
Free Daily Mining $15  1day(4.00%) $0.60  $0.60 
Newbie experience $100  2days(3.00%) $3  $6 
Classic Primary Miner II $1,000  10days(1.25%) $12.50  $125 
Classic Intermediate Miner I $5,000  20days(1.35%) $67.50  $1,350 
Classic Intermediate Miner II $10,000  30days(1.5%) $150  $4,500 
Classic Intermediate Miner III $30,000 45 days (1.6%) $480 $21,600
Classic Advanced Miner I $100,000 50days(1.72%) $1,720 $86,000
Classic Advanced Miner I II $300,000 60days(2.00%) $6,000 $360,000

Join winnermining and start your journey to wealth. The registration process is simple and can be completed in less than a minute : quick one-click registration !

In short:

Cryptocurrencies have unlimited financial growth potential, and WinnerMining’s cloud mining is the most profitable and safe option. Investors can earn daily passive income without relying on Bitcoin’s price fluctuations. Make your Bitcoin active – start cloud mining now and achieve your financial freedom!

For more information, please visit the official website:

https:// winnermining.com/

Business cooperation :

info@ winnermining.com

Disclaimer: The information provided in this press release does not constitute an investment solicitation, nor does it constitute investment advice, financial advice, or a trading recommendation. Cryptocurrency mining and staking involve risks and may result in loss of funds. It is strongly recommended that you perform due diligence before investing or trading in cryptocurrencies and securities, including consulting a professional financial advisor.

 
J.S. Held Expands the Office of the Chief Intellectual Property Officer
The Roadmap to Securing Your Own Digital Domain is Now Available
AB Anywhere: $AB Goes Live on Binance, Ushering in a New Era of Cross-Chain Asset Mobility
PEXX Launches Borderless USD Neo-Bank for the Global Generation
Vantage Foundation Joins The Habbit Factory to Empower Young Voices Through Creative Confidence
TAGGED:activelyassetassetsbackdropbitcoincloudcryptocurrencydigitalemergingevolvingfacedfloridaforceglobalglobehighefficiencyimportantinvestorsjunelowthresholdmarketmiamiminingnewswireparticipateplatformrapidlyseekingwayswinnermining
Share This Article
Facebook Copy Link Print
- Advertisement -

Your Trusted Source for Accurate and Timely Updates!

Our commitment to accuracy, impartiality, and delivering breaking news as it happens has earned us the trust of a vast audience. Stay ahead with real-time updates on the latest events, trends.
FacebookLike
XFollow
PinterestPin
InstagramFollow
YoutubeSubscribe
LinkedInFollow
MediumFollow

Most Selling Products

Top Picks, Trending Now – Discover the Best Sellers!
Tecno Camon 20 Premier 5G

Tecno Camon 20 Premier 5G

Dark Welkin | 8GB RAM + 512GB Storage (Expandable RAM up to 16GB) | Industry’s 1st 50MP RGBW-Pro Camera | Segment-First 108MP Ultra-Wide Macro Lens | 6.67" 120Hz 10-bit AMOLED In-Display

iQOO Z10 Lite 5G

iQOO Z10 Lite 5G

Titanium Blue | 6GB RAM + 128GB Storage | Dimensity 6300 5G with 433K+ AnTuTu Score | Robust 6000mAh Battery | IP64 Rated + Military-Grade Shock Resistance

OnePlus 13s

OnePlus 13s

Black Velvet | 12GB RAM + 256GB Storage | Flagship Snapdragon® 8 Elite Chipset | Exceptional Battery Life in a Compact Form | Lifetime Display Warranty Included

Samsung Galaxy A55 5G

Samsung Galaxy A55 5G

Awesome Iceblue | 8GB RAM + 256GB Storage | Premium Metal Frame | 50MP OIS Main Camera with Nightography | IP67 Water & Dust Resistance | Gorilla Glass Victus+ | sAMOLED Display with Vision Booster

You Might Also Like

NYSE Content Advisory: Pre-Market Update + S&P 500 closes above 6,600 for first time

17/09/2025
Telangana Leads with Long-Term Financial Thinking: 94% Prefer to Plan Ahead, 87% Consider Life Insurance Savings Plans
Business

Telangana Leads with Long-Term Financial Thinking: 94% Prefer to Plan Ahead, 87% Consider Life Insurance Savings Plans

02/09/2025
Rendever Receives Nearly .5 Million in NIH Funding to Overcome Social Isolation for Older Adults while Supporting Caregivers
Health

Rendever Receives Nearly $4.5 Million in NIH Funding to Overcome Social Isolation for Older Adults while Supporting Caregivers

03/11/2025
FY Energy Expands Green Energy Cloud Computing Contracts to Support Low-Carbon Blockchain Infrastructure
Tech

FY Energy Expands Green Energy Cloud Computing Contracts to Support Low-Carbon Blockchain Infrastructure

01/09/2025
Life Care News
Facebook Twitter Youtube Rss Medium

Life Care News:


We increase the awareness of millions of users through our news networks. We are one of the most trusted news networks in the world.

Top Categories
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Usefull Links
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Copyright © 2015 – 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Life Care NewsLife Care News
Copyright © 2015 - 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?