Friday, 15 Aug 2025
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Subscribe
Life Care News
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
    NewsShow More
    Clarivate Partners with the University of Melbourne to Transform Library Systems
    Clarivate Partners with the University of Melbourne to Transform Library Systems
    15/08/2025
    O-RAN ALLIANCE Opens Call for Participation in its O-RAN Global PlugFest Fall 2025
    O-RAN ALLIANCE Opens Call for Participation in its O-RAN Global PlugFest Fall 2025
    15/08/2025
    Bigg Boss 19: Fans to choose Shehbaz Badesha or Mridul Tiwari as one of the contestants
    Bigg Boss 19: Fans to choose Shehbaz Badesha or Mridul Tiwari as one of the contestants
    14/08/2025
    IndoStar Capital Finance reports PAT  535 crore, AUM  7,783 crore, Disbursement  858 crore
    IndoStar Capital Finance reports PAT 535 crore, AUM 7,783 crore, Disbursement 858 crore
    14/08/2025
    Technology sector anchors ~40% office leasing while global enterprises expand India operations: Colliers
    Technology sector anchors ~40% office leasing while global enterprises expand India operations: Colliers
    14/08/2025
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
  • 🔥
  • news
  • june
  • july
  • global
  • Business
  • today
  • announced
  • Tech
  • company
  • leading
Font ResizerAa
Life Care NewsLife Care News
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Search
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Follow US
© 2022 Foxiz News Network. Ruby Design Company. All Rights Reserved.
News

Vantage Markets Celebrates Award and Successful Debut at Wealth Expo Peru 2025

PRNW Agency
Last updated: 04/07/2025 10:19 AM
PRNW Agency
Share
4 Min Read
Vantage Markets Celebrates Award and Successful Debut at Wealth Expo Peru 2025
SHARE
Vantage Markets Celebrates Award and Successful Debut at Wealth Expo Peru 2025

PORT VILA, Vanuatu, July 3, 2025 /PRNewswire/ — Vantage Markets marked its first appearance at Wealth Expo Peru 2025, held in the financial heart of San Isidro at The Westin Lima Hotel. The event brought together key players from the local and regional financial community – ranging from investors and fintech innovators to brokers and trading professionals.

- Advertisement -

As a main sponsor, Vantage underscored its commitment to supporting financial education and regional dialogue. The event served as a strategic platform for Vantage to showcase its trading tools, copy trading solutions, and operational framework to a broad audience within one of Latin America’s fastest growing financial communities.

- Advertisement -

Kicking off the event, Vantage hosted an exclusive cocktail reception the evening before the expo. The event welcomed clients, partners, and fintech leaders, offering a relaxed and sophisticated setting to exchange ideas and foster collaboration. The reception helped set the tone for a strong and engaging presence throughout the main event.

Vantage was honored with the “Best Regulated Trading Platform” award during the event—an accolade that recognizes the company’s excellence in compliance, technology, and trust. The award reflects Vantage’s commitment to maintaining a secure and transparent environment for traders globally.

- Advertisement -

Vantage also contributed to the event’s content-rich agenda through multiple speaking engagements:

- Advertisement -
  • Rodrigo Martínez, Business Development Team Lead, delivered a keynote on “Vantage: Smart Copy Trading Within Everyone’s Reach.” His session outlined how modern tools, such as Vantage’s proprietary copy trading solution, are designed to provide tools suitable for traders of different experience levels.
  • Martínez also participated in a panel discussion exploring regional developments and regulatory shifts in the financial ecosystem, offering a forward-looking perspective on how global best practices can support market maturity.
  • Julio Vásquez, Business Development Manager, led a hands-on workshop focused on practical strategies for leveraging online communities and digital tools as part of a broader trading approach.

“We appreciated the strong engagement at the event” said Marc Despallieres, CEO of Vantage Markets. From industry recognition to dynamic conversations with the community, Wealth Expo Peru provided valuable insights from this dynamic financial environment. We look forward to continuing to support financial education and innovation   within the trading community.”

As Vantage continues engaging with financial communities globally, the firm remains focused on delivering secure, innovative, and user-friendly trading experiences – supported by education, regulatory alignment, and a client-first philosophy.

- Advertisement -

About Vantage

- Advertisement -

Vantage Markets (or Vantage) is a multi-asset CFD broker offering clients access to a nimble and powerful service for trading Contracts for Difference (CFDs) products, including Forex, Commodities, Indices, Shares, ETFs, and Bonds.

With over 15 years of market experience, Vantage transcends the role of broker, providing a reliable trading platform, an award-winning mobile trading app, and a user-friendly trading platform that provide clients access to trading opportunities.

- Advertisement -

trade smarter @vantage

- Advertisement -

RISK WARNING : CFDs are complex instruments and carry a high risk of losing money rapidly due to leverage. Ensure you understand the risks before trading.

Disclaimer: This article is provided for informational purposes only and does not constitute financial advice, an offer, or solicitation of any financial products or services. The content is not intended for residents of any jurisdiction where such distribution or use would be contrary to local law or regulation. Readers are advised to seek independent professional advice before making any investment or financial decisions. Any reliance you place on the information presented is strictly at your own risk.

- Advertisement -

Photo – https://mma.prnewswire.com/media/2723620/Vantage_Markets_Celebrates_Award_Successful_Debut_Wealth_Expo_Peru_2025.jpg
Photo – https://mma.prnewswire.com/media/2723621/Vantage_contributed_event_s_content_rich_agenda_multiple_speaking_engagements.jpg
Logo – https://mma.prnewswire.com/media/2506103/Vantage_15_Logo_Logo.jpg

- Advertisement -

View original content:https://www.prnewswire.co.uk/news-releases/vantage-markets-celebrates-award-and-successful-debut-at-wealth-expo-peru-2025-302497430.html

Brandwatch and Trajaan Partner to Bring World-Class Search Intelligence to Consumer Insights
WEB3 Meets Edtech as Geninfinity Introduces Blockchain Identity Tools for All Users
Three years to go: LA28 competition schedule revealed as PlayLA programme surpasses one million registrations
ClicknClear Wins 2025 WIPO Global Award Honoured by the UN’s Intellectual Property Agency for Innovation with Global Impact
Databricks Launches Free Edition and Announces $100 Million Investment to Develop the Next Generation of Data and AI Talent
TAGGED: and2025appearanceawardbroughtcelebratesdebuteventexpofinancialfintechfirstheartheldhotelisidrojulykeylimamainmarkedmarketsnewsperúplayersportreceptionregionalsansuccessfultogethertradingvantagevanuatuvilawealthwestin
Share This Article
Facebook Copy Link Print
- Advertisement -

Your Trusted Source for Accurate and Timely Updates!

Our commitment to accuracy, impartiality, and delivering breaking news as it happens has earned us the trust of a vast audience. Stay ahead with real-time updates on the latest events, trends.
FacebookLike
XFollow
PinterestPin
InstagramFollow
YoutubeSubscribe
LinkedInFollow
MediumFollow

Most Selling Products

Top Picks, Trending Now – Discover the Best Sellers!
Tecno Camon 20 Premier 5G

Tecno Camon 20 Premier 5G

Dark Welkin | 8GB RAM + 512GB Storage (Expandable RAM up to 16GB) | Industry’s 1st 50MP RGBW-Pro Camera | Segment-First 108MP Ultra-Wide Macro Lens | 6.67" 120Hz 10-bit AMOLED In-Display

iQOO Z10 Lite 5G

iQOO Z10 Lite 5G

Titanium Blue | 6GB RAM + 128GB Storage | Dimensity 6300 5G with 433K+ AnTuTu Score | Robust 6000mAh Battery | IP64 Rated + Military-Grade Shock Resistance

OnePlus 13s

OnePlus 13s

Black Velvet | 12GB RAM + 256GB Storage | Flagship Snapdragon® 8 Elite Chipset | Exceptional Battery Life in a Compact Form | Lifetime Display Warranty Included

Samsung Galaxy A55 5G

Samsung Galaxy A55 5G

Awesome Iceblue | 8GB RAM + 256GB Storage | Premium Metal Frame | 50MP OIS Main Camera with Nightography | IP67 Water & Dust Resistance | Gorilla Glass Victus+ | sAMOLED Display with Vision Booster

You Might Also Like

CisionOne Wins “Best Media Monitoring Solution” for Second Consecutive Year at 2025 MarTech Breakthrough Awards
Business

CisionOne Wins “Best Media Monitoring Solution” for Second Consecutive Year at 2025 MarTech Breakthrough Awards

15/08/2025
XRP mining launches new application: available to users around the world
Tech

XRP mining launches new application: available to users around the world

21/06/2025
Beko Scales Up Climate Action with Green Electricity and Refurbishment
Tech

Beko Scales Up Climate Action with Green Electricity and Refurbishment

28/07/2025
EatProtein Launches New Plant Based (Vegan) Protein Powder Specifically Designed for Womens Wellness
Sports

EatProtein Launches New Plant Based (Vegan) Protein Powder Specifically Designed for Womens Wellness

06/07/2025
Life Care News
Facebook Twitter Youtube Rss Medium

Life Care News:


We increase the awareness of millions of users through our news networks. We are one of the most trusted news networks in the world.

Top Categories
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Usefull Links
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Copyright © 2015 – 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Life Care NewsLife Care News
Copyright © 2015 - 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?