Thursday, 3 Jul 2025
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Subscribe
Life Care News
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
    NewsShow More
    Queen Mxima of the Netherlands Appointed Chair of Global Finance & Technology Network’s International Advisory Board
    Queen Mxima of the Netherlands Appointed Chair of Global Finance & Technology Network’s International Advisory Board
    03/07/2025
    Indie Fashion Brand IshqMe Pays Tribute to Nature with its New Enchanting Garden Collection
    Indie Fashion Brand IshqMe Pays Tribute to Nature with its New Enchanting Garden Collection
    03/07/2025
    Hon’ble MP Dr. Ashok Kumar Mittal Highlights India’s Commitment to Global Cooperation and Anti-Terrorism During Slovenia Visit
    Hon’ble MP Dr. Ashok Kumar Mittal Highlights India’s Commitment to Global Cooperation and Anti-Terrorism During Slovenia Visit
    02/07/2025
    Big Bang Boom Solutions Accelerates Deployment of the Indigenous Vajra Sentinel System to the Indian Air Force in Response to Operation Sindoor
    Big Bang Boom Solutions Accelerates Deployment of the Indigenous Vajra Sentinel System to the Indian Air Force in Response to Operation Sindoor
    02/07/2025
    Kalam & Kavach 2.0 Conclave Charts Roadmap for Defence Reforms, Innovation and Self-Reliance in 2025
    Kalam & Kavach 2.0 Conclave Charts Roadmap for Defence Reforms, Innovation and Self-Reliance in 2025
    02/07/2025
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
  • 🔥
  • june
  • Business
  • global
  • today
  • announced
  • Tech
  • company
  • globe
  • newswire
  • will
Font ResizerAa
Life Care NewsLife Care News
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Search
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Follow US
© 2022 Foxiz News Network. Ruby Design Company. All Rights Reserved.
News

Kalam & Kavach 2.0 Conclave Charts Roadmap for Defence Reforms, Innovation and Self-Reliance in 2025

News Voir
Last updated: 02/07/2025 3:36 PM
News Voir
Share
2 Min Read
Kalam & Kavach 2.0 Conclave Charts Roadmap for Defence Reforms, Innovation and Self-Reliance in 2025
SHARE
Kalam & Kavach 2.0 Conclave Charts Roadmap for Defence Reforms, Innovation and Self-Reliance in 2025

Kalam & Kavach 2.0, hosted by Pentagon Press in collaboration with CENJOWS, brought together India’s top defence minds-from military leadership and think tanks to private industry-to shape the next wave of military reform. Themed “2025: The Year of Reforms,” the conclave, held at the Manekshaw Centre, focused on speed, synergy, and self-reliance in national defence.

Kalam & Kavach Panel discussion: Indian industry and defence start-ups hailed as co-creators of capability and self-reliance


Key Highlights

  • Strategic Insight: Lt Gen Vipul Shinghal, delivering the keynote on behalf of the CDS, cited a “renaissance in strategic thought,” revealing 8-9 new doctrines in progress.

  • Airpower & Future Warfare: In a fireside chat with Shivam Arya, curator Kalam & Kavach, former IAF chief ACM V.R. Chaudhari emphasized jointness, AI-driven warfare, and theatre commands as future priorities.

  • Security Outlook: Lt Gen Raj Shukla (Retd) and author Sandeep Unnithan discussed drones, grey zone threats, and the need for rapid, tech-led reform.

  • Technology as a Force Multiplier: Experts stressed AI, quantum, cyber, and space as the defining arenas of modern warfare.

  • Industry’s Role: From “vendor to vanguard,” Indian industry and defence startups were hailed as co-creators of capability and self-reliance.

Books Released
Cyber Diplomacy, Artificial Intelligence in Military Applications, and India’s Arsenal captured the spirit of innovation driving the sector.

Closing Note
Maj Gen (Dr) Ashok Kumar called for action-oriented follow-up, while curator Shivam Arya urged, “The conversations we had today must now become contributions.”


Kalam & Kavach 2.0 reaffirmed that defence transformation begins with dialogue-and must end in decisive, indigenised action.

HUAWEI XMAGE Awards 2025 Open with Aim to Make Powerful Imaging Accessible to All
Valneva Announces Availability of Documentation for its Combined Shareholder Meeting and Provides Corporate Update
Successful UK market entry programme set to launch for third consecutive year at London Tech Week
Vantage Dominates Online Money Awards 2025 with Wins for Best Multi-Asset Broker & Customer Service
Manufacturers and Logistics Providers Embrace AI for Enhanced Barcode Reading Performance
TAGGED: and for2.02025broughtcenjowschartscollaborationconclavedefenceheldhostedindia’sindustrytoInnovationkalamkavachleadershipmanekshawmilitarymindsfromnewsnextpentagonpressprivatereformreformsroadmapself-relianceselfrelianceshapetanksthemedthinktogethertopwaveyear
Share This Article
Facebook Copy Link Print
- Advertisement -

Your Trusted Source for Accurate and Timely Updates!

Our commitment to accuracy, impartiality, and delivering breaking news as it happens has earned us the trust of a vast audience. Stay ahead with real-time updates on the latest events, trends.
FacebookLike
XFollow
PinterestPin
InstagramFollow
YoutubeSubscribe
LinkedInFollow
MediumFollow

Most Selling Products

Top Picks, Trending Now – Discover the Best Sellers!
Tecno Camon 20 Premier 5G

Tecno Camon 20 Premier 5G

Dark Welkin | 8GB RAM + 512GB Storage (Expandable RAM up to 16GB) | Industry’s 1st 50MP RGBW-Pro Camera | Segment-First 108MP Ultra-Wide Macro Lens | 6.67" 120Hz 10-bit AMOLED In-Display

iQOO Z10 Lite 5G

iQOO Z10 Lite 5G

Titanium Blue | 6GB RAM + 128GB Storage | Dimensity 6300 5G with 433K+ AnTuTu Score | Robust 6000mAh Battery | IP64 Rated + Military-Grade Shock Resistance

OnePlus 13s

OnePlus 13s

Black Velvet | 12GB RAM + 256GB Storage | Flagship Snapdragon® 8 Elite Chipset | Exceptional Battery Life in a Compact Form | Lifetime Display Warranty Included

Samsung Galaxy A55 5G

Samsung Galaxy A55 5G

Awesome Iceblue | 8GB RAM + 256GB Storage | Premium Metal Frame | 50MP OIS Main Camera with Nightography | IP67 Water & Dust Resistance | Gorilla Glass Victus+ | sAMOLED Display with Vision Booster

You Might Also Like

Vodafone Qatar selects Nokia in major network modernization deal to drive expanded 5G coverage, reliability, and services
Tech

Vodafone Qatar selects Nokia in major network modernization deal to drive expanded 5G coverage, reliability, and services

02/06/2025
Canara HSBC Life Insurance signs Indian cricket icon Jasprit Bumrah and celebrated sports presenter Sanjana Ganesan as brand ambassadors
Business

Canara HSBC Life Insurance signs Indian cricket icon Jasprit Bumrah and celebrated sports presenter Sanjana Ganesan as brand ambassadors

23/06/2025
Instil Bio Announces U.S. F.D.A. Clearance of Investigational New Drug (IND) Application for AXN-2510, a PD-L1xVEGF Bispecific Antibody, for a Phase 1 Trial in Relapsed/Refractory Solid Tumors
Health

Instil Bio Announces U.S. F.D.A. Clearance of Investigational New Drug (IND) Application for AXN-2510, a PD-L1xVEGF Bispecific Antibody, for a Phase 1 Trial in Relapsed/Refractory Solid Tumors

02/07/2025
Elliott Calls for Further Action to Enhance Corporate Value and Strengthen Corporate Governance Ahead of Sumitomo Realty’s 2025 Annual General Meeting
News

Elliott Calls for Further Action to Enhance Corporate Value and Strengthen Corporate Governance Ahead of Sumitomo Realty’s 2025 Annual General Meeting

09/06/2025
Life Care News
Facebook Twitter Youtube Rss Medium

Life Care News:


We increase the awareness of millions of users through our news networks. We are one of the most trusted news networks in the world.

Top Categories
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Usefull Links
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Copyright © 2015 – 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Life Care NewsLife Care News
Copyright © 2015 - 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?