Tuesday, 10 Mar 2026
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Subscribe
Life Care News
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
    NewsShow More
    World Customs Organization praises ‘e-commerce platform’ in trilingual report
    World Customs Organization praises ‘e-commerce platform’ in trilingual report
    31/12/2025
    Shri Acharya Devvrat, Governor of Gujarat, and Union Ministers Shri Kinjarapu Ram Mohan Naidu & Gajendra Singh Shekhawat Grace Namotsav at Sanskardham
    Shri Acharya Devvrat, Governor of Gujarat, and Union Ministers Shri Kinjarapu Ram Mohan Naidu & Gajendra Singh Shekhawat Grace Namotsav at Sanskardham
    31/12/2025
    International Forum “Problem-Solving City: Hong Kong as a Disputes Resolver”
    International Forum “Problem-Solving City: Hong Kong as a Disputes Resolver”
    28/12/2025
    Roca Group opens the Roca Delhi Gallery, its first in India, as part of its international network of design-led cultural spaces
    Roca Group opens the Roca Delhi Gallery, its first in India, as part of its international network of design-led cultural spaces
    28/12/2025
    Confidence Surges Among Small Enterprises Despite Global Headwinds, Reflecting India’s Strong Economic Momentum – ASSOCHAM Dun & Bradstreet Small Business Confidence Index
    Confidence Surges Among Small Enterprises Despite Global Headwinds, Reflecting India’s Strong Economic Momentum – ASSOCHAM Dun & Bradstreet Small Business Confidence Index
    27/12/2025
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
  • 🔥
  • news
  • global
  •  and
  •  the
  • announced
  • today
  • Business
  • Tech
  •  for
  • will
Font ResizerAa
Life Care NewsLife Care News
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Search
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Follow US
© 2022 Foxiz News Network. Ruby Design Company. All Rights Reserved.
Business

CQ Medical Appoints Michael Galbus as Chief Executive Officer, Mike Sutter as Chairman of the Board of Directors

PRNW Agency
Last updated: 04/11/2025 5:31 AM
PRNW Agency
Share
4 Min Read
CQ Medical Appoints Michael Galbus as Chief Executive Officer, Mike Sutter as Chairman of the Board of Directors
SHARE
CQ Medical Appoints Michael Galbus as Chief Executive Officer, Mike Sutter as Chairman of the Board of Directors

AVONDALE, Pa., Nov. 3, 2025 /PRNewswire/ — CQ Medical is pleased to announce the appointment of Michael Galbus as Chief Executive Officer. Michael previously served as Chief Operating Officer, where he played a key role in enhancing operational performance, advancing the company’s growth strategy, and building trust across the executive team while championing the growth and development of his team members.

- Advertisement -

A cancer survivor, Michael has a deeply personal connection to CQ Medical’s mission of improving care and outcomes for patients and clinicians. He is recognized for his collaborative leadership style, sharp strategic mindset, and ability to turn ambitious goals into measurable results. Over the past several years, he has consistently fostered innovation, execution, and team development across the organization.

- Advertisement -

Michael brings more than 30 years of leadership experience across highly regulated industries, including aerospace, building products, chemicals, and medical devices. He has learned to quickly identify what makes organizations in different sectors succeed and has applied those insights to deliver performance and growth. His leadership journey has included senior roles at global companies such as Dow Inc., Saint-Gobain, Zodiac Aerospace, and ACTEGA, culminating in his appointment as CEO of CQ Medical. He holds a bachelor’s degree in mechanical engineering from the University of Delaware and an MBA from Purdue University.

- Advertisement -

As CEO, Michael will focus on developing strategy and supporting teams in creating actionable operating plans, advancing the company’s acquisition and integration efforts, and reinforcing a culture of trust, accountability, and innovation.

- Advertisement -

“CQ Medical has a unique opportunity to innovate in ways that directly impact patients and those who care for them,” said Michael. “I look forward to building on the strong foundation we have created, partnering with our teams and customers worldwide, and continuing to deliver on our mission.”

- Advertisement -

Michael and his wife Crystal live in the greater Philadelphia area, where they have raised their three children: Connor, Carter, and Madelyn. Outside of work, he enjoys running, restoring classic cars, and following collegiate and professional sports. He values the same qualities in these pursuits and in family life as he does at work: commitment, resilience, and celebrating milestones together.

- Advertisement -

Mike Sutter, CQ Medical’s outgoing CEO, has been named Chairman of CQ Medical’s Board of Directors, allowing him to continue his strategic contributions to the company in a new capacity. “I’m excited to transition into a new role at CQ Medical so we can continue the progress we’ve made as a team over the past several years. Under Michael’s leadership, I believe the company is poised to accelerate growth and realize our full potential to innovate and deliver the best outcomes for patients.”

- Advertisement -

About CQ Medical

As the global leader in patient radiotherapy positioning and healthcare innovation, CQ Medical unites intelligence (IQ) and empathy (EQ) to define its unique Care Quotient (CQ). Guided by this philosophy, the company transforms ideas into innovations that advance precision, elevate technology, and empower medical excellence for improved patient outcomes.

- Advertisement -

For additional information, please visit CQmedical.com or connect with CQ Medical on LinkedIn and Facebook.

- Advertisement -

COPYRIGHT © 2025 CQ Medical. All rights reserved. CQ Medical is a registered trademark of CQ Medical.

- Advertisement -

Photo – https://mma.prnewswire.com/media/2811886/CQ_Medical_Michael_Galbus.jpg

- Advertisement -

View original content:https://www.prnewswire.co.uk/news-releases/cq-medical-appoints-michael-galbus-as-chief-executive-officer-mike-sutter-as-chairman-of-the-board-of-directors-302602843.html

- Advertisement -
Lumina Datamatics Earns Great Place To Work Certification for the 3rd Successive Year
Medidata and the University of Sydney’s NHMRC Clinical Trials Centre Broaden Efforts to Revolutionize Clinical Studies in Australia
TribeWood: A Premium Solid Wood Furniture Sub-Brand Released by Tribesigns
Net Rowdex: Why Net Rowdex 2025 Emerges as a Next-Gen AI Trading Platform for Investors Read France Report!
More countries now require tobacco plain packaging and graphic health warnings on cigarette packages
TAGGED: cq theacrossaerospaceannounceappointmentappointsavondaleboardbuildingchairmanchiefdevelopmentdirectorsenhancingexecutivegalbusgrowthkeyleadershipmedicalmichaelmikenewsnovofficeroperatingoperationalperformanceplayedpleasedpreviouslyroleservedsutterteamuniversityyears
Share This Article
Facebook Copy Link Print
- Advertisement -

Your Trusted Source for Accurate and Timely Updates!

Our commitment to accuracy, impartiality, and delivering breaking news as it happens has earned us the trust of a vast audience. Stay ahead with real-time updates on the latest events, trends.
FacebookLike
XFollow
PinterestPin
InstagramFollow
YoutubeSubscribe
LinkedInFollow
MediumFollow

Most Selling Products

Top Picks, Trending Now – Discover the Best Sellers!
Tecno Camon 20 Premier 5G

Tecno Camon 20 Premier 5G

Dark Welkin | 8GB RAM + 512GB Storage (Expandable RAM up to 16GB) | Industry’s 1st 50MP RGBW-Pro Camera | Segment-First 108MP Ultra-Wide Macro Lens | 6.67" 120Hz 10-bit AMOLED In-Display

iQOO Z10 Lite 5G

iQOO Z10 Lite 5G

Titanium Blue | 6GB RAM + 128GB Storage | Dimensity 6300 5G with 433K+ AnTuTu Score | Robust 6000mAh Battery | IP64 Rated + Military-Grade Shock Resistance

OnePlus 13s

OnePlus 13s

Black Velvet | 12GB RAM + 256GB Storage | Flagship Snapdragon® 8 Elite Chipset | Exceptional Battery Life in a Compact Form | Lifetime Display Warranty Included

Samsung Galaxy A55 5G

Samsung Galaxy A55 5G

Awesome Iceblue | 8GB RAM + 256GB Storage | Premium Metal Frame | 50MP OIS Main Camera with Nightography | IP67 Water & Dust Resistance | Gorilla Glass Victus+ | sAMOLED Display with Vision Booster

You Might Also Like

Advanced Instruments is Now Merged Under the Nova Biomedical Name: One Unified Brand Driving Innovation
News

Advanced Instruments is Now Merged Under the Nova Biomedical Name: One Unified Brand Driving Innovation

16/10/2025
Luma Nutrition Magnesium Glycinate Surpasses 10,000 Monthly Sales on Amazon
Health

Luma Nutrition Magnesium Glycinate Surpasses 10,000 Monthly Sales on Amazon

08/07/2025
Bybit x Block Scholes September Volatility Report: Volatility Awakens with the First Term Structure Inversion in Months
Business

Bybit x Block Scholes September Volatility Report: Volatility Awakens with the First Term Structure Inversion in Months

24/10/2025
Fermenta Board Approves INR 110 Crore Capex at Dahej for Plant-based Vitamin D3, Green Chemistry Enzyme, and Vitamin D3 Derivatives
Health

Fermenta Board Approves INR 110 Crore Capex at Dahej for Plant-based Vitamin D3, Green Chemistry Enzyme, and Vitamin D3 Derivatives

10/12/2025
Life Care News
Facebook Twitter Youtube Rss Medium

Life Care News:


We increase the awareness of millions of users through our news networks. We are one of the most trusted news networks in the world.

Top Categories
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Usefull Links
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Copyright © 2015 – 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Life Care NewsLife Care News
Copyright © 2015 - 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?