Thursday, 12 Mar 2026
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Subscribe
Life Care News
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
    NewsShow More
    World Customs Organization praises ‘e-commerce platform’ in trilingual report
    World Customs Organization praises ‘e-commerce platform’ in trilingual report
    31/12/2025
    Shri Acharya Devvrat, Governor of Gujarat, and Union Ministers Shri Kinjarapu Ram Mohan Naidu & Gajendra Singh Shekhawat Grace Namotsav at Sanskardham
    Shri Acharya Devvrat, Governor of Gujarat, and Union Ministers Shri Kinjarapu Ram Mohan Naidu & Gajendra Singh Shekhawat Grace Namotsav at Sanskardham
    31/12/2025
    International Forum “Problem-Solving City: Hong Kong as a Disputes Resolver”
    International Forum “Problem-Solving City: Hong Kong as a Disputes Resolver”
    28/12/2025
    Roca Group opens the Roca Delhi Gallery, its first in India, as part of its international network of design-led cultural spaces
    Roca Group opens the Roca Delhi Gallery, its first in India, as part of its international network of design-led cultural spaces
    28/12/2025
    Confidence Surges Among Small Enterprises Despite Global Headwinds, Reflecting India’s Strong Economic Momentum – ASSOCHAM Dun & Bradstreet Small Business Confidence Index
    Confidence Surges Among Small Enterprises Despite Global Headwinds, Reflecting India’s Strong Economic Momentum – ASSOCHAM Dun & Bradstreet Small Business Confidence Index
    27/12/2025
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
  • 🔥
  • news
  • global
  •  and
  •  the
  • announced
  • today
  • Business
  • Tech
  •  for
  • will
Font ResizerAa
Life Care NewsLife Care News
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Search
  • Home
  • Business
    • Business Wire
    • Globenews Wire
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Follow US
© 2022 Foxiz News Network. Ruby Design Company. All Rights Reserved.
Health

Zelluna ASA Reports Second Quarter 2025 Financial Results and Provides General Business Update

GlobeNews Wire
Last updated: 20/08/2025 1:31 PM
GlobeNews Wire
Share
4 Min Read
Zelluna ASA Reports Second Quarter 2025 Financial Results and Provides General Business Update
SHARE
Zelluna ASA Reports Second Quarter 2025 Financial Results and Provides General Business Update

Oslo, Norway, 20 August 2025 – Zelluna (OSE: ZLNA), a company pioneering allogeneic “off-the-shelf” T-cell receptor-based natural killer (TCR-NK) therapies for the treatment of cancer, announces its second quarter 2025 results today.

Webcast scheduled for 20 August 2025, at 09:00 (CET). Link to webcast here.

Second Quarter 2025 Business Update

Highlights

  • On track toward IND/CTA submission in 2H 2025 and first-in-human trial initiation in 1H 2026.
  • Broadened regulatory engagement: following positive FDA pre-IND feedback (Q2 2024), submitted a scientific advice briefing package to the UK MHRA in July 2025 for ZI-MA4-1.
  • Initiated GMP manufacturing of clinical material in July 2025, a major step in clinical readiness; scalable platform developed with Catalent can deliver hundreds of doses from a single batch.
  • Strong support from leading clinical experts and sites; refined trial design and moving to operational readiness ahead of IND/CTA submission

Financial highlights

  • Total operating expenses amounted to MNOK 38.4 in Q2 2025, and MNOK 67.8 YTD. Total loss was MNOK 37.5 for the period and MNOK 66.0 YTD.
  • Net negative cash flow from operations was MNOK 59.4 in Q2 2025, and net decrease in cash and cash equivalents, excluding currency effects, was MNOK 59.0 during Q2 2025. Cash and cash equivalents amounted to MNOK 76.0 as per 30 June 2025.
  • The current cash is expected to give a financial runway into Q2 2026, slightly shortened from the previously guided ‘through Q2 2026’ due to some one-off cost elements mainly related to investment in the successful development of the TCR-NK manufacturing process. The expected financial runway reflects that the cash burn rate is forecasted to come down significantly from the Q2 2025 level.
  • On 27 May 2025, Zelluna ASA issued 227,096 new shares, each with a subscription price of NOK 26, to settle an amount of EUR 500,000 of an already triggered option exercise fee towards Inven2.

The quarterly report and presentation will be published at 07:00 CET on 20 August 2025, and will be publicly available on the Zelluna website. The Company will conduct a webcast at 09:00 CET the same day, and questions can be submitted throughout the event. The webcast will be archived for replay following the conference call. Link to webcast here.

For further information, please see www.zelluna.com or contact:

Namir Hassan, CEO, Zelluna ASA
Email: namir.hassan@zelluna.com
Phone: +44 7720 687608

Hans Vassgård Eid, CFO, Zelluna ASA
Email: hans.eid@zelluna.com
Phone: +47 482 48632

About Zelluna ASA

Zelluna’s mission is to deliver transformative treatments with the capacity to cure advanced solid cancers, in a safe and cost-efficient manner, to patients on a global scale. The Company aims to do this by combining the most powerful elements of the immune system through pioneering the development of “off-the-shelf” T-cell receptor (TCR) guided natural killer (NK) cell therapies (TCR-NK). The TCR-NK platform offers a unique mechanism of action with broad cancer detection capability to overcome the diversity of tumours and will be used “off-the-shelf” to overcome scaling limitations of current cell therapies. The lead program is a world’s first MAGE-A4 targeting “off-the-shelf” TCR-NK for the treatment of various solid cancers; a pipeline of earlier products follows. The Company is led by a management team of biotech entrepreneurs with deep experience in discovery through clinical development of TCR and cell-based therapies including marketed products.

For more information, please visit www.zelluna.com

This stock exchange announcement was published by Joachim Midttun, Financial Manager at Zelluna ASA, on 20 August 2025 at 07:00 CET.

  • Zelluna-ASA-Q225-Report
  • Zelluna-ASA-Q225-Presentation
Q1 FY26 – Delivers 63% YoY PAT Growth; Strengthens Balance Sheet with 900 Cr QIP
METABORA Partners with LINE NEXT to Distribute Web3 Games via Mini Dapp
Rapid Micro Biosystems Reports Third Quarter 2025 Financial Results; Announces Record Multi-System Customer Order and Raises Full-Year Revenue and System Placement Guidance
Lotpot Comics Collaborates with Shin chan A Delightful Fusion of Two Iconic Kids' Entertainment Worlds
Infoblox Streamlines IP Address Management Across Hybrid Cloud Environments with AWS
TAGGED: and2025allogeneicasaaugustBusinesscancer announcescetcompanyfinancialgeneralkillernaturalnewsNO0013524942norwayofftheshelfoseosloOslo:ZLApioneeringprovidesquarterreceptorbasedreportsresultsscheduledsecondtcelltcrnktherapiestodaytreatmentupdatewebcastzellunazlna
Share This Article
Facebook Copy Link Print
- Advertisement -

Your Trusted Source for Accurate and Timely Updates!

Our commitment to accuracy, impartiality, and delivering breaking news as it happens has earned us the trust of a vast audience. Stay ahead with real-time updates on the latest events, trends.
FacebookLike
XFollow
PinterestPin
InstagramFollow
YoutubeSubscribe
LinkedInFollow
MediumFollow

Most Selling Products

Top Picks, Trending Now – Discover the Best Sellers!
Tecno Camon 20 Premier 5G

Tecno Camon 20 Premier 5G

Dark Welkin | 8GB RAM + 512GB Storage (Expandable RAM up to 16GB) | Industry’s 1st 50MP RGBW-Pro Camera | Segment-First 108MP Ultra-Wide Macro Lens | 6.67" 120Hz 10-bit AMOLED In-Display

iQOO Z10 Lite 5G

iQOO Z10 Lite 5G

Titanium Blue | 6GB RAM + 128GB Storage | Dimensity 6300 5G with 433K+ AnTuTu Score | Robust 6000mAh Battery | IP64 Rated + Military-Grade Shock Resistance

OnePlus 13s

OnePlus 13s

Black Velvet | 12GB RAM + 256GB Storage | Flagship Snapdragon® 8 Elite Chipset | Exceptional Battery Life in a Compact Form | Lifetime Display Warranty Included

Samsung Galaxy A55 5G

Samsung Galaxy A55 5G

Awesome Iceblue | 8GB RAM + 256GB Storage | Premium Metal Frame | 50MP OIS Main Camera with Nightography | IP67 Water & Dust Resistance | Gorilla Glass Victus+ | sAMOLED Display with Vision Booster

You Might Also Like

Celebrating 100 years, Duas Rodas unveils its new brand DR Flavors & Ingredients and begins a new cycle of evolution
Food

Celebrating 100 years, Duas Rodas unveils its new brand DR Flavors & Ingredients and begins a new cycle of evolution

02/12/2025
Herbalife India Recognised as ‘Leader of the Year – Consumer Health’ at the 12th IAA Leadership Awards
Entertainment

Herbalife India Recognised as ‘Leader of the Year – Consumer Health’ at the 12th IAA Leadership Awards

08/08/2025
Athletes at the heart
Sports

Athletes at the heart

10/07/2025

CHRIS GOTTERUP VICTORIOUS AT THE 2025 GENESIS SCOTTISH OPEN

17/07/2025
Life Care News
Facebook Twitter Youtube Rss Medium

Life Care News:


We increase the awareness of millions of users through our news networks. We are one of the most trusted news networks in the world.

Top Categories
  • Home
  • Business
  • News
  • Tech
  • Health
  • Sports
  • Entertainment
  • Automobile
Usefull Links
  • About Us
  • Contact Us
  • Terms and Conditions
  • Privacy Policy
Copyright © 2015 – 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Life Care NewsLife Care News
Copyright © 2015 - 2025 LifeCareNews Network. All Rights Reserved. LIFE CARE IS REGISTERED MAGAZINE IN RNI, NO.GUJGUJ/2015/71283
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?